| UniProt ID | YPQ1_YEAST | |
|---|---|---|
| UniProt AC | Q12010 | |
| Protein Name | Probable vacuolar amino acid transporter YPQ1 | |
| Gene Name | YPQ1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 308 | |
| Subcellular Localization |
Vacuole membrane Multi-pass membrane protein . |
|
| Protein Description | May function as an amino acid transporter mediating the export of cationic amino acids from the vacuole.. | |
| Protein Sequence | MQLVPLELNRSTLSGISGSISISCWIIVFVPQIYENFYRKSSDGLSLLFVVLWLAGDVFNLMGAVMQHLLSTMIILAAYYTVADIILLGQCLWYDNEEKPAVDPIHLSPANPINENVLHDVFNEQQPLLNSQGQPNRIDEEMAAPSSDGNAGDDNLREVNSRNLIKDIFIVSGVVFVGFISWYVTYCVNYTQPPPVEDPSLPVPELQINWMAQIFGYLSALLYLGSRIPQILLNFKRKSCEGISFLFFLFACLGNTTFIFSVIVISLDWKYLIMNASWLVGSIGTLFMDFVIFSQFFIYKRNKKFILN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | N-linked_Glycosylation | QLVPLELNRSTLSGI CCEEEEECHHHHCCC | - | ||
| 146 | Phosphorylation | DEEMAAPSSDGNAGD CHHHCCCCCCCCCCC | 22369663 | ||
| 147 | Phosphorylation | EEMAAPSSDGNAGDD HHHCCCCCCCCCCCC | 22369663 | ||
| 189 | N-linked_Glycosylation | WYVTYCVNYTQPPPV HHHHHHCCCCCCCCC | - | ||
| 275 | N-linked_Glycosylation | DWKYLIMNASWLVGS CHHHHHHCHHHHHHH | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YPQ1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YPQ1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YPQ1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HAP3_YEAST | HAP3 | genetic | 20093466 | |
| TRS85_YEAST | TRS85 | genetic | 20093466 | |
| PT122_YEAST | PET122 | genetic | 20093466 | |
| YFK5_YEAST | YFR035C | genetic | 20093466 | |
| MTO1_YEAST | MTO1 | genetic | 20093466 | |
| YGY5_YEAST | YGL235W | genetic | 20093466 | |
| HUR1_YEAST | HUR1 | genetic | 20093466 | |
| PEX14_YEAST | PEX14 | genetic | 20093466 | |
| NPR3_YEAST | NPR3 | genetic | 20093466 | |
| MTC6_YEAST | MTC6 | genetic | 20093466 | |
| ACA2_YEAST | CST6 | genetic | 20093466 | |
| RM49_YEAST | MRP49 | genetic | 20093466 | |
| COXM1_YEAST | CMC1 | genetic | 20093466 | |
| HAP4_YEAST | HAP4 | genetic | 20093466 | |
| ODP2_YEAST | LAT1 | genetic | 20093466 | |
| ATP23_YEAST | ATP23 | genetic | 20093466 | |
| CY1_YEAST | CYT1 | genetic | 20093466 | |
| COQ7_YEAST | CAT5 | genetic | 20093466 | |
| MSC6_YEAST | MSC6 | genetic | 20093466 | |
| YAR1_YEAST | YAR1 | genetic | 20093466 | |
| NCBP2_YEAST | CBC2 | genetic | 20093466 | |
| COX10_YEAST | COX10 | genetic | 20093466 | |
| UBA3_YEAST | UBA3 | genetic | 20093466 | |
| QCR2_YEAST | QCR2 | genetic | 20093466 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
