| UniProt ID | RLP24_YEAST | |
|---|---|---|
| UniProt AC | Q07915 | |
| Protein Name | Ribosome biogenesis protein RLP24 | |
| Gene Name | RLP24 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 199 | |
| Subcellular Localization | Cytoplasm . Nucleus . Shuttles between the nucleus and the cytoplasm. | |
| Protein Description | Involved in the biogenesis of the 60S ribosomal subunit. Ensures the docking of NOG1 to pre-60S particles.. | |
| Protein Sequence | MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDFLRDKKLVESNPELLRIREVEIARKLAKEQERAESVSEQEESEEEEEDMEIDSDEEEEEQLEKQKILLKNRRRNTKKIAF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 27 | Ubiquitination | MFVRNDAKEFRFCRS EEEECCHHHHHHHHH | 61.32 | 23749301 | |
| 48 | Ubiquitination | KQRRNPRKLKWTKAF HHHCCHHHHHHHHHH | 56.53 | 22817900 | |
| 50 | Ubiquitination | RRNPRKLKWTKAFRK HCCHHHHHHHHHHHH | 56.72 | 22817900 | |
| 53 | Ubiquitination | PRKLKWTKAFRKAAG HHHHHHHHHHHHHHC | 44.40 | 22817900 | |
| 57 | Ubiquitination | KWTKAFRKAAGKELA HHHHHHHHHHCCCHH | 35.81 | 22817900 | |
| 61 | Ubiquitination | AFRKAAGKELAVDST HHHHHHCCCHHHHCC | 44.84 | 23749301 | |
| 61 | Acetylation | AFRKAAGKELAVDST HHHHHHCCCHHHHCC | 44.84 | 24489116 | |
| 67 | Phosphorylation | GKELAVDSTLTFAQR CCCHHHHCCCCHHHH | 20.79 | 30377154 | |
| 70 | Phosphorylation | LAVDSTLTFAQRRNV HHHHCCCCHHHHCCC | 19.60 | 30377154 | |
| 91 | Ubiquitination | ELVATTLKAMARIEE HHHHHHHHHHHHHHH | 33.74 | 23749301 | |
| 125 | Ubiquitination | KDFLRDKKLVESNPE HHHHHHHHHHHHCHH | 63.15 | 23749301 | |
| 129 | Phosphorylation | RDKKLVESNPELLRI HHHHHHHHCHHHHHH | 50.64 | 22369663 | |
| 144 | Ubiquitination | REVEIARKLAKEQER HHHHHHHHHHHHHHH | 43.72 | 15699485 | |
| 147 | Acetylation | EIARKLAKEQERAES HHHHHHHHHHHHHHH | 71.07 | 25381059 | |
| 154 | Phosphorylation | KEQERAESVSEQEES HHHHHHHHCCHHHHH | 29.93 | 23749301 | |
| 156 | Phosphorylation | QERAESVSEQEESEE HHHHHHCCHHHHHHH | 42.73 | 23749301 | |
| 161 | Phosphorylation | SVSEQEESEEEEEDM HCCHHHHHHHHHHHC | 49.94 | 23749301 | |
| 172 | Phosphorylation | EEDMEIDSDEEEEEQ HHHCCCCCCHHHHHH | 53.21 | 21551504 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RLP24_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RLP24_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RLP24_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-129 AND SER-172, ANDMASS SPECTROMETRY. | |
