UniProt ID | AAD3_YEAST | |
---|---|---|
UniProt AC | P25612 | |
Protein Name | Putative aryl-alcohol dehydrogenase AAD3 | |
Gene Name | AAD3 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 363 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MIGSASDSSSKLGRLRFLSETAAIKVSPLILGEVSYDGARSDFLKSMNKNRAFELLDTFYEAGGNFIDAANNCQNEQSEEWIGEWIQSRRLRDQIVIATKFIKSDKKYKAGESNTANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHWWDYMSSIEEFMDSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSYGKTPFSIYQGKWNVLNRDFERDIIPMARHFGMALAPWDVMGGGRFQSKKAMEERRKNGEGIRSFVGASEQTDAEIKISEALAKIAEEHGTESVTAIAIAYVRSKAKNFFPSVEGGKIEDLKENIKALSIDLTPDNIKYLESIVPFDIGFPNNFIVLNSLTQKYGTNNV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AAD3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AAD3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AAD3_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AIR1_YEAST | AIR1 | genetic | 20093466 | |
YHM2_YEAST | YHM2 | genetic | 20093466 | |
MDM12_YEAST | MDM12 | genetic | 20093466 | |
PTP2_YEAST | PTP2 | genetic | 27708008 | |
RL21B_YEAST | RPL21B | genetic | 27708008 | |
BDF2_YEAST | BDF2 | genetic | 27708008 | |
YD109_YEAST | YDL109C | genetic | 27708008 | |
ODO2_YEAST | KGD2 | genetic | 27708008 | |
MRM2_YEAST | MRM2 | genetic | 27708008 | |
MDM34_YEAST | MDM34 | genetic | 27708008 | |
AIR1_YEAST | AIR1 | genetic | 27708008 | |
MSC1_YEAST | MSC1 | genetic | 27708008 | |
CYB5_YEAST | CYB5 | genetic | 27708008 | |
MDM12_YEAST | MDM12 | genetic | 27708008 | |
LCF1_YEAST | FAA1 | genetic | 27708008 | |
ARL3_YEAST | ARL3 | genetic | 27708008 | |
ATG5_YEAST | ATG5 | genetic | 27708008 | |
KIP2_YEAST | KIP2 | genetic | 27708008 | |
ATG29_YEAST | ATG29 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...