UniProt ID | YBC8_YEAST | |
---|---|---|
UniProt AC | P38202 | |
Protein Name | UPF0642 protein YBL028C | |
Gene Name | YBL028C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 106 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAKSLRASSHLNAKSVKRRGVFQKAVDAREQRISDKLKEDLLKQKLEDLKKKEEQGIDMDVDEKKSNEEAPRKKISTSGWRDGRHHTYKKAKLMKQSKKKTSFTRF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | AKSLRASSHLNAKSV CCHHHHHCCCCHHHH | 30.89 | 25882841 | |
24 | Acetylation | KRRGVFQKAVDAREQ HHHHHHHHHHHHHHH | 38.62 | 24489116 | |
36 | Acetylation | REQRISDKLKEDLLK HHHHHHHHHHHHHHH | 55.45 | 24489116 | |
38 | Acetylation | QRISDKLKEDLLKQK HHHHHHHHHHHHHHH | 55.72 | 24489116 | |
66 | Phosphorylation | MDVDEKKSNEEAPRK CCCCHHHCCCCCCCH | 61.62 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBC8_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBC8_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBC8_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EBP2_YEAST | EBP2 | physical | 18467557 | |
IF2B_YEAST | SUI3 | genetic | 19061648 | |
UAF30_YEAST | UAF30 | genetic | 19061648 | |
YD012_YEAST | YDL012C | genetic | 27708008 | |
SLT2_YEAST | SLT2 | genetic | 27708008 | |
YL149_YEAST | YLR149C | genetic | 27708008 | |
SCS7_YEAST | SCS7 | genetic | 27708008 | |
KTR1_YEAST | KTR1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...