UniProt ID | SDCB2_HUMAN | |
---|---|---|
UniProt AC | Q9H190 | |
Protein Name | Syntenin-2 | |
Gene Name | SDCBP2 {ECO:0000312|HGNC:HGNC:15756} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 292 | |
Subcellular Localization | Cytoplasm . Nucleus, nucleolus . Nucleus, nucleoplasm . Cell membrane . Nucleus speckle . Associates with intracellular membranes and enriched in the apical region of the cell and in intracellular compartments (PubMed:11102519). Colocalizes with TM4S | |
Protein Description | Binds phosphatidylinositol 4,5-bisphosphate (PIP2). May play a role in the organization of nuclear PIP2, cell division and cell survival. [PubMed: 15961997] | |
Protein Sequence | MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSSLYPSLE ------CCCCCCCHH | 29.11 | 24043423 | |
3 | Phosphorylation | -----MSSLYPSLED -----CCCCCCCHHH | 30.53 | 20068231 | |
5 | Phosphorylation | ---MSSLYPSLEDLK ---CCCCCCCHHHCC | 7.85 | 29255136 | |
7 | Phosphorylation | -MSSLYPSLEDLKVD -CCCCCCCHHHCCHH | 30.73 | 29255136 | |
24 | Phosphorylation | IQAQVRASPKMPALP HHHHHHCCCCCCCCC | 17.94 | 25159151 | |
93 | Phosphorylation | MVAPVTGYSLGVRRA EEEECCEEEECEEHH | 7.43 | 21253578 | |
94 | Ubiquitination | VAPVTGYSLGVRRAE EEECCEEEECEEHHE | 21.71 | 29901268 | |
176 | Phosphorylation | HQVVKKASGDKIVVV HHHHHHHCCCEEEEE | 57.30 | 27134283 | |
179 | Ubiquitination | VKKASGDKIVVVVRD HHHHCCCEEEEEECC | 40.71 | 29901268 | |
288 | Phosphorylation | LHHTMDHSIPDA--- HHHCCCCCCCCC--- | 31.39 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SDCB2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SDCB2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SDCB2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...