UniProt ID | ZN581_HUMAN | |
---|---|---|
UniProt AC | Q9P0T4 | |
Protein Name | Zinc finger protein 581 | |
Gene Name | ZNF581 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 197 | |
Subcellular Localization | Nucleus . | |
Protein Description | May be involved in transcriptional regulation.. | |
Protein Sequence | MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MLVLPSPCPQPLA --CCCCCCCCCCCCC | 34.67 | 24043423 | |
15 | Phosphorylation | CPQPLAFSSVETMEG CCCCCCCCCCCCCCC | 28.06 | 24043423 | |
16 | Phosphorylation | PQPLAFSSVETMEGP CCCCCCCCCCCCCCC | 19.95 | 24043423 | |
19 | Phosphorylation | LAFSSVETMEGPPRR CCCCCCCCCCCCCCC | 20.54 | 24043423 | |
30 | Phosphorylation | PPRRTCRSPEPGPSS CCCCCCCCCCCCCCC | 35.44 | 21406692 | |
36 | Phosphorylation | RSPEPGPSSSIGSPQ CCCCCCCCCCCCCCC | 42.50 | 21406692 | |
37 | Phosphorylation | SPEPGPSSSIGSPQA CCCCCCCCCCCCCCC | 29.16 | 21406692 | |
38 | Phosphorylation | PEPGPSSSIGSPQAS CCCCCCCCCCCCCCC | 34.99 | 21406692 | |
41 | Phosphorylation | GPSSSIGSPQASSPP CCCCCCCCCCCCCCC | 16.51 | 21406692 | |
45 | Phosphorylation | SIGSPQASSPPRPNH CCCCCCCCCCCCCCE | 37.82 | 21406692 | |
46 | Phosphorylation | IGSPQASSPPRPNHY CCCCCCCCCCCCCEE | 41.77 | 21406692 | |
53 | Phosphorylation | SPPRPNHYLLIDTQG CCCCCCEEEEEECCC | 15.16 | 21406692 | |
58 | Phosphorylation | NHYLLIDTQGVPYTV CEEEEEECCCCEEEE | 21.89 | 21406692 | |
63 | Phosphorylation | IDTQGVPYTVLVDEE EECCCCEEEEEECHH | 13.69 | 21406692 | |
64 | Phosphorylation | DTQGVPYTVLVDEES ECCCCEEEEEECHHH | 10.99 | 21406692 | |
71 | Phosphorylation | TVLVDEESQREPGAS EEEECHHHHCCCCCC | 32.27 | 21406692 | |
78 | Phosphorylation | SQREPGASGAPGQKK HHCCCCCCCCCCCCC | 41.21 | 21406692 | |
108 | Phosphorylation | YLQRHSITHSEVKPF HHHHCCCCCCCCCCE | 23.51 | 28555341 | |
110 | Phosphorylation | QRHSITHSEVKPFEC HHCCCCCCCCCCEEC | 35.12 | 28555341 | |
168 | Phosphorylation | AQHSRVHSGERPFQC HHHCCCCCCCCCCCC | 39.22 | 29214152 | |
183 | Sulfoxidation | PHCPRRFMEQNTLQK CCCCHHHHHHCCCHH | 4.99 | 21406390 | |
190 | Ubiquitination | MEQNTLQKHTRWKHP HHHCCCHHCCCCCCC | 50.48 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN581_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN581_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN581_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...