UniProt ID | DIRA2_HUMAN | |
---|---|---|
UniProt AC | Q96HU8 | |
Protein Name | GTP-binding protein Di-Ras2 | |
Gene Name | DIRAS2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 199 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | Displays low GTPase activity and exists predominantly in the GTP-bound form.. | |
Protein Sequence | MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | AGGVGKSSLVLRFVK CCCCCCHHHHHHHHC | 26.44 | 20860994 | |
29 | Ubiquitination | SLVLRFVKGTFRESY HHHHHHHCCCCHHHC | 49.90 | 21890473 | |
31 | Phosphorylation | VLRFVKGTFRESYIP HHHHHCCCCHHHCCC | 17.50 | 28857561 | |
35 | Phosphorylation | VKGTFRESYIPTVED HCCCCHHHCCCCHHH | 24.89 | 28857561 | |
75 | Phosphorylation | FPAMQRLSISKGHAF CCCEEEEEECCCCEE | 27.31 | 29496963 | |
77 | Phosphorylation | AMQRLSISKGHAFIL CEEEEEECCCCEEEE | 29.25 | 26699800 | |
113 | Phosphorylation | EIKGDVESIPIMLVG HHCCCHHHCCEEEEC | 33.25 | 23879269 | |
126 | Phosphorylation | VGNKCDESPSREVQS ECCCCCCCCCCCCCH | 18.22 | - | |
175 | Phosphorylation | LEKRRTVSLQIDGKK CHHHCEEEEEECCCC | 17.59 | 26074081 | |
189 | Acetylation | KSKQQKRKEKLKGKC CHHHHHHHHHHCCCE | 67.26 | 90827 | |
191 | Acetylation | KQQKRKEKLKGKCVI HHHHHHHHHCCCEEE | 59.54 | 90831 | |
196 | Methylation | KEKLKGKCVIM---- HHHHCCCEEEC---- | 3.23 | - | |
196 | Geranylgeranylation | KEKLKGKCVIM---- HHHHCCCEEEC---- | 3.23 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DIRA2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DIRA2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DIRA2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UN13B_HUMAN | UNC13B | physical | 28514442 | |
GDS1_HUMAN | RAP1GDS1 | physical | 28514442 | |
FTO_HUMAN | FTO | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...