HIKES_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HIKES_HUMAN
• UniProt AC: Q53FT3
• Protein Name: Protein Hikeshi {ECO:0000305}
• Gene Name: HIKESHI {ECO:0000312|HGNC:HGNC:26938}
• Organism: Homo sapiens (Human).
• Sequence Length: 197
• Subcellular Localization: Cytoplasm . Cytoplasm, cytosol . Nucleus .
• Protein Description: Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat shock damages. Does not translocate ADP-bound HSP70 proteins into the nucleus..
• Protein Sequence: MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
85	Phosphorylation	PSAIFKISGLKSGEG CCEEEEECCCCCCCC	38.37	24719451
88	Ubiquitination	IFKISGLKSGEGSQH EEEECCCCCCCCCCC	61.00	29967540
196	Ubiquitination	AQNPLFWKT------ HCCCCCCCC------	36.70	-
197	Phosphorylation	QNPLFWKT------- CCCCCCCC-------	34.14	21712546

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HIKES_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HIKES_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HIKES_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
CLC3A_HUMAN	CLEC3A	physical	28514442
TR61B_HUMAN	TRMT61B	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.