UniProt ID | CLC3A_HUMAN | |
---|---|---|
UniProt AC | O75596 | |
Protein Name | C-type lectin domain family 3 member A | |
Gene Name | CLEC3A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 197 | |
Subcellular Localization | Secreted . | |
Protein Description | Promotes cell adhesion to laminin-332 and fibronectin.. | |
Protein Sequence | MAKNGLVICILVITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKEIQALQTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFTIPQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | VICILVITLLLDQTT HHHHHHHHHHHHCCC | 12.13 | 22210691 | |
25 | Phosphorylation | DQTTSHTSRLKARKH HCCCCCHHHHHHHHH | 30.14 | - | |
53 | Phosphorylation | TQIEKLWTEVNALKE HHHHHHHHHHHHHHH | 40.26 | 28102081 | |
79 | Phosphorylation | TKVHKKCYLASEGLK CCCHHHHHHHHHHHH | 17.74 | 28152594 | |
82 | Phosphorylation | HKKCYLASEGLKHFH HHHHHHHHHHHHHHH | 29.60 | 28152594 | |
108 | Phosphorylation | ILVIPRNSDEINALQ EEEECCCHHHHHHHH | 37.59 | 27251275 | |
117 | Phosphorylation | EINALQDYGKRSLPG HHHHHHHHHHCCCCC | 16.16 | 27251275 | |
173 | Phosphorylation | NCVLFSQSAQGKWSD CEEEEECCCCCCCCH | 22.74 | 24260401 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLC3A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLC3A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLC3A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...