UniProt ID | ZN593_HUMAN | |
---|---|---|
UniProt AC | O00488 | |
Protein Name | Zinc finger protein 593 | |
Gene Name | ZNF593 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 134 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | Negatively modulates the DNA binding activity of Oct-2 and therefore its transcriptional regulatory activity. Could act either by binding to DNA octamer or by interacting with Oct-2. May also be a modulator of other octamer-binding proteins.. | |
Protein Sequence | MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Phosphorylation | RELRPQGSARPQPDP HHHCCCCCCCCCCCC | 18.83 | 28555341 | |
73 | Phosphorylation | CARYFIDSTNLKTHF HHHHHHHCCCHHHHC | 17.87 | 29214152 | |
90 | Ubiquitination | KDHKKRLKQLSVEPY HHHHHHHHHCCCCCC | 53.91 | 2190698 | |
97 | Phosphorylation | KQLSVEPYSQEEAER HHCCCCCCCHHHHHH | 14.96 | 23663014 | |
98 | Phosphorylation | QLSVEPYSQEEAERA HCCCCCCCHHHHHHH | 41.66 | 23663014 | |
114 | Phosphorylation | GMGSYVPPRRLAVPT CCCCCCCHHHCCCCC | 24.79 | 18669648 | |
115 | Phosphorylation | MGSYVPPRRLAVPTE CCCCCCHHHCCCCCE | 39.93 | 18669648 | |
116 | Phosphorylation | GSYVPPRRLAVPTEV CCCCCHHHCCCCCEE | 32.54 | 18669648 | |
121 | Phosphorylation | PRRLAVPTEVSTEVP HHHCCCCCEECCCCC | 42.28 | 24732914 | |
124 | Phosphorylation | LAVPTEVSTEVPEMD CCCCCEECCCCCCCC | 16.78 | 24732914 | |
125 | Phosphorylation | AVPTEVSTEVPEMDT CCCCEECCCCCCCCC | 46.29 | 24732914 | |
132 | Phosphorylation | TEVPEMDTST----- CCCCCCCCCC----- | 32.71 | 30278072 | |
133 | Phosphorylation | EVPEMDTST------ CCCCCCCCC------ | 28.05 | 30278072 | |
134 | Phosphorylation | VPEMDTST------- CCCCCCCC------- | 44.73 | 30278072 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN593_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN593_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN593_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LNX1_HUMAN | LNX1 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...