ZN593_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ZN593_HUMAN
• UniProt AC: O00488
• Protein Name: Zinc finger protein 593
• Gene Name: ZNF593
• Organism: Homo sapiens (Human).
• Sequence Length: 134
• Subcellular Localization: Nucleus, nucleolus .
• Protein Description: Negatively modulates the DNA binding activity of Oct-2 and therefore its transcriptional regulatory activity. Could act either by binding to DNA octamer or by interacting with Oct-2. May also be a modulator of other octamer-binding proteins..
• Protein Sequence: MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
40	Phosphorylation	RELRPQGSARPQPDP HHHCCCCCCCCCCCC	18.83	28555341
73	Phosphorylation	CARYFIDSTNLKTHF HHHHHHHCCCHHHHC	17.87	29214152
90	Ubiquitination	KDHKKRLKQLSVEPY HHHHHHHHHCCCCCC	53.91	2190698
97	Phosphorylation	KQLSVEPYSQEEAER HHCCCCCCCHHHHHH	14.96	23663014
98	Phosphorylation	QLSVEPYSQEEAERA HCCCCCCCHHHHHHH	41.66	23663014
114	Phosphorylation	GMGSYVPPRRLAVPT CCCCCCCHHHCCCCC	24.79	18669648
115	Phosphorylation	MGSYVPPRRLAVPTE CCCCCCHHHCCCCCE	39.93	18669648
116	Phosphorylation	GSYVPPRRLAVPTEV CCCCCHHHCCCCCEE	32.54	18669648
121	Phosphorylation	PRRLAVPTEVSTEVP HHHCCCCCEECCCCC	42.28	24732914
124	Phosphorylation	LAVPTEVSTEVPEMD CCCCCEECCCCCCCC	16.78	24732914
125	Phosphorylation	AVPTEVSTEVPEMDT CCCCEECCCCCCCCC	46.29	24732914
132	Phosphorylation	TEVPEMDTST----- CCCCCCCCCC-----	32.71	30278072
133	Phosphorylation	EVPEMDTST------ CCCCCCCCC------	28.05	30278072
134	Phosphorylation	VPEMDTST------- CCCCCCCC-------	44.73	30278072

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ZN593_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ZN593_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ZN593_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LNX1_HUMAN	LNX1	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.