| UniProt ID | GOPC_HUMAN | |
|---|---|---|
| UniProt AC | Q9HD26 | |
| Protein Name | Golgi-associated PDZ and coiled-coil motif-containing protein | |
| Gene Name | GOPC | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 462 | |
| Subcellular Localization |
Cytoplasm. Golgi apparatus membrane Peripheral membrane protein. Golgi apparatus, trans-Golgi network membrane Peripheral membrane protein. Cell junction, synapse. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Cell projection |
|
| Protein Description | Plays a role in intracellular protein trafficking and degradation. May regulate CFTR chloride currents and acid-induced ASIC3 currents by modulating cell surface expression of both channels. May also regulate the intracellular trafficking of the ADR1B receptor. May play a role in autophagy. Overexpression results in CFTR intracellular retention and degradation in the lysosomes.. | |
| Protein Sequence | MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSAGGPCPA ------CCCCCCCCC | 35.30 | 19413330 | |
| 2 | Phosphorylation | ------MSAGGPCPA ------CCCCCCCCC | 35.30 | 19413330 | |
| 19 | Phosphorylation | GGGPGGASCSVGAPG CCCCCCCCCCCCCCC | 15.36 | 28348404 | |
| 21 | Phosphorylation | GPGGASCSVGAPGGV CCCCCCCCCCCCCCC | 22.53 | 28348404 | |
| 39 | Ubiquitination | RWLEVLEKEFDKAFV HHHHHHHHHHHHHHC | 60.56 | 29967540 | |
| 86 | Phosphorylation | QLCHKAQSVSQINHK HHHHHHHCHHHHCHH | 28.70 | 25849741 | |
| 88 | Phosphorylation | CHKAQSVSQINHKLE HHHHHCHHHHCHHHH | 30.50 | 30622161 | |
| 93 | Ubiquitination | SVSQINHKLEAQLVD CHHHHCHHHHHHHCH | 43.46 | 32015554 | |
| 93 | Malonylation | SVSQINHKLEAQLVD CHHHHCHHHHHHHCH | 43.46 | 26320211 | |
| 93 | Acetylation | SVSQINHKLEAQLVD CHHHHCHHHHHHHCH | 43.46 | 20167786 | |
| 102 | Sumoylation | EAQLVDLKSELTETQ HHHHCHHHHHCCHHH | 37.10 | - | |
| 102 (in isoform 3) | Ubiquitination | - | 37.10 | 21906983 | |
| 102 (in isoform 2) | Ubiquitination | - | 37.10 | 21906983 | |
| 102 | Sumoylation | EAQLVDLKSELTETQ HHHHCHHHHHCCHHH | 37.10 | - | |
| 102 (in isoform 1) | Ubiquitination | - | 37.10 | 21906983 | |
| 102 | Ubiquitination | EAQLVDLKSELTETQ HHHHCHHHHHCCHHH | 37.10 | 21906983 | |
| 103 | Phosphorylation | AQLVDLKSELTETQA HHHCHHHHHCCHHHH | 45.17 | 26074081 | |
| 106 | Phosphorylation | VDLKSELTETQAEKV CHHHHHCCHHHHHHH | 32.70 | 26074081 | |
| 108 | Phosphorylation | LKSELTETQAEKVVL HHHHCCHHHHHHHHH | 28.04 | 26074081 | |
| 112 | 2-Hydroxyisobutyrylation | LTETQAEKVVLEKEV CCHHHHHHHHHCHHH | 40.43 | - | |
| 112 | Ubiquitination | LTETQAEKVVLEKEV CCHHHHHHHHHCHHH | 40.43 | 29967540 | |
| 136 | Ubiquitination | IQLQLHAKTGQSADS EEEEEECCCCCCCCC | 42.30 | 29967540 | |
| 143 | Phosphorylation | KTGQSADSGTIKAKL CCCCCCCCCEEEEEC | 37.24 | 27251275 | |
| 145 | Phosphorylation | GQSADSGTIKAKLSG CCCCCCCEEEEECCC | 24.21 | 28857561 | |
| 145 (in isoform 2) | Phosphorylation | - | 24.21 | - | |
| 147 | Ubiquitination | SADSGTIKAKLSGPS CCCCCEEEEECCCCC | 39.03 | 27667366 | |
| 147 (in isoform 1) | Ubiquitination | - | 39.03 | 21906983 | |
| 147 (in isoform 2) | Ubiquitination | - | 39.03 | 21906983 | |
| 147 (in isoform 3) | Ubiquitination | - | 39.03 | 21906983 | |
| 149 | Ubiquitination | DSGTIKAKLSGPSVE CCCEEEEECCCCCHH | 37.88 | 30230243 | |
| 151 | Phosphorylation | GTIKAKLSGPSVEEL CEEEEECCCCCHHHH | 48.20 | 26657352 | |
| 154 | Phosphorylation | KAKLSGPSVEELERE EEECCCCCHHHHHHH | 45.76 | 22985185 | |
| 170 | Sulfoxidation | EANKKEKMKEAQLEA HHHHHHHHHHHHHHH | 5.07 | 21406390 | |
| 171 | Ubiquitination | ANKKEKMKEAQLEAE HHHHHHHHHHHHHHH | 62.05 | - | |
| 172 | Ubiquitination | NKKEKMKEAQLEAEV HHHHHHHHHHHHHHH | 37.84 | 29967540 | |
| 180 | Ubiquitination | AQLEAEVKLLRKENE HHHHHHHHHHHHHHH | 33.05 | 29967540 | |
| 200 | Ubiquitination | IAVLQAEVYGARLAA HHHHHHHHHHHHHHH | 6.31 | 29967540 | |
| 201 | Phosphorylation | AVLQAEVYGARLAAK HHHHHHHHHHHHHHH | 9.14 | 18083107 | |
| 204 | Ubiquitination | QAEVYGARLAAKYLD HHHHHHHHHHHHHHC | 22.09 | 29967540 | |
| 208 | Ubiquitination | YGARLAAKYLDKELA HHHHHHHHHHCHHHH | 40.51 | 29967540 | |
| 209 | Phosphorylation | GARLAAKYLDKELAG HHHHHHHHHCHHHHH | 18.53 | 18083107 | |
| 212 | Ubiquitination | LAAKYLDKELAGRVQ HHHHHHCHHHHHHHH | 52.62 | 29967540 | |
| 270 | Ubiquitination | KRPMQAPPGHDQDSL CCCCCCCCCCCHHHH | 56.62 | 29967540 | |
| 271 | Ubiquitination | RPMQAPPGHDQDSLK CCCCCCCCCCHHHHH | 35.62 | 29967540 | |
| 276 | Phosphorylation | PPGHDQDSLKKSQGV CCCCCHHHHHHHCCC | 36.13 | 28985074 | |
| 278 | Ubiquitination | GHDQDSLKKSQGVGP CCCHHHHHHHCCCCC | 55.09 | 29967540 | |
| 279 | Ubiquitination | HDQDSLKKSQGVGPI CCHHHHHHHCCCCCC | 53.99 | 29967540 | |
| 280 | Phosphorylation | DQDSLKKSQGVGPIR CHHHHHHHCCCCCCC | 30.49 | 29743597 | |
| 302 | Phosphorylation | DHEGLGISITGGKEH CCCCCEEEECCCHHH | 16.58 | 28348404 | |
| 342 | Ubiquitination | AILAVNGVNLRDTKH EEEEECCCCCCCCCC | 5.27 | 33845483 | |
| 350 | Ubiquitination | NLRDTKHKEAVTILS CCCCCCCHHHHHHHH | 49.26 | 33845483 | |
| 369 | Phosphorylation | EIEFEVVYVAPEVDS EEEEEEEEEECCCCC | 8.96 | 26657352 | |
| 376 | Phosphorylation | YVAPEVDSDDENVEY EEECCCCCCCCCCEE | 52.73 | 27362937 | |
| 383 | Phosphorylation | SDDENVEYEDESGHR CCCCCCEEECCCCCE | 25.13 | 26074081 | |
| 387 | Phosphorylation | NVEYEDESGHRYRLY CCEEECCCCCEEEEE | 52.82 | 26074081 | |
| 391 | Phosphorylation | EDESGHRYRLYLDEL ECCCCCEEEEEEEEC | 10.17 | 26074081 | |
| 394 | Phosphorylation | SGHRYRLYLDELEGG CCCEEEEEEEECCCC | 11.78 | 28796482 | |
| 401 | Ubiquitination | YLDELEGGGNPGASC EEEECCCCCCCCCCC | 24.27 | 29967540 | |
| 407 | Phosphorylation | GGGNPGASCKDTSGE CCCCCCCCCCCCCCC | 27.84 | 29507054 | |
| 408 | Ubiquitination | GGNPGASCKDTSGEI CCCCCCCCCCCCCCE | 4.60 | 32015554 | |
| 409 | Ubiquitination | GNPGASCKDTSGEIK CCCCCCCCCCCCCEE | 62.64 | 29967540 | |
| 411 | Phosphorylation | PGASCKDTSGEIKVL CCCCCCCCCCCEEEE | 24.91 | 21712546 | |
| 412 | Phosphorylation | GASCKDTSGEIKVLQ CCCCCCCCCCEEEEE | 44.56 | 29214152 | |
| 415 | Ubiquitination | CKDTSGEIKVLQGFN CCCCCCCEEEEECCC | 4.22 | 29967540 | |
| 416 | Sumoylation | KDTSGEIKVLQGFNK CCCCCCEEEEECCCC | 32.37 | - | |
| 416 | Ubiquitination | KDTSGEIKVLQGFNK CCCCCCEEEEECCCC | 32.37 | 32015554 | |
| 416 | Sumoylation | KDTSGEIKVLQGFNK CCCCCCEEEEECCCC | 32.37 | - | |
| 423 | 2-Hydroxyisobutyrylation | KVLQGFNKKAVTDTH EEEECCCCCCCCCCC | 39.59 | - | |
| 423 | Ubiquitination | KVLQGFNKKAVTDTH EEEECCCCCCCCCCC | 39.59 | 29967540 | |
| 437 | Phosphorylation | HENGDLGTASETPLD CCCCCCCCCCCCCCC | 34.02 | 26657352 | |
| 439 | Phosphorylation | NGDLGTASETPLDDG CCCCCCCCCCCCCCC | 41.67 | 25159151 | |
| 441 | Phosphorylation | DLGTASETPLDDGAS CCCCCCCCCCCCCCC | 27.02 | 28985074 | |
| 451 | Ubiquitination | DDGASKLDDLHTLYH CCCCCCHHHHHHHHC | 61.23 | 29967540 | |
| 455 | Phosphorylation | SKLDDLHTLYHKKSY CCHHHHHHHHCCCCC | 35.99 | 29978859 | |
| 457 | Phosphorylation | LDDLHTLYHKKSY-- HHHHHHHHCCCCC-- | 16.85 | 14729942 | |
| 459 | Ubiquitination | DLHTLYHKKSY---- HHHHHHCCCCC---- | 29.83 | 29967540 | |
| 461 | Phosphorylation | HTLYHKKSY------ HHHHCCCCC------ | 40.66 | 24719451 | |
| 462 | Phosphorylation | TLYHKKSY------- HHHCCCCC------- | 31.30 | 14729942 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GOPC_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GOPC_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Robust phosphoproteomic profiling of tyrosine phosphorylation sitesfrom human T cells using immobilized metal affinity chromatography andtandem mass spectrometry."; Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M.,Peters E.C.; Anal. Chem. 76:2763-2772(2004). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-457 AND TYR-462, ANDMASS SPECTROMETRY. | |