| UniProt ID | AKIR1_HUMAN | |
|---|---|---|
| UniProt AC | Q9H9L7 | |
| Protein Name | Akirin-1 | |
| Gene Name | AKIRIN1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 192 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | ||
| Protein Sequence | MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQPAPPGSERRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFTLRQVGIICERLLKDYEDKIREEYEQILNTKLAEQYESFVKFTHDQIMRRYGTRPTSYVS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MACGATLKRPMEF --CCCCCCCCCCCHH | 20.35 | 46161611 | |
| 8 | Methylation | MACGATLKRPMEFEA CCCCCCCCCCCHHHH | 50.53 | - | |
| 8 | Ubiquitination | MACGATLKRPMEFEA CCCCCCCCCCCHHHH | 50.53 | 24816145 | |
| 19 | Phosphorylation | EFEAALLSPGSPKRR HHHHHHCCCCCCCCC | 28.23 | 30266825 | |
| 22 | Phosphorylation | AALLSPGSPKRRRCA HHHCCCCCCCCCCCC | 30.54 | 30266825 | |
| 72 | Phosphorylation | GSERRLPTPEQIFQN CCCCCCCCHHHHHHH | 44.01 | 25159151 | |
| 118 | Phosphorylation | SSALTAPSSPGSSWM CCCCCCCCCCCCCCC | 46.85 | 28348404 | |
| 119 | Phosphorylation | SALTAPSSPGSSWMK CCCCCCCCCCCCCCC | 32.02 | 30576142 | |
| 127 | Ubiquitination | PGSSWMKKDQPTFTL CCCCCCCCCCCCEEH | 45.55 | - | |
| 133 | Phosphorylation | KKDQPTFTLRQVGII CCCCCCEEHHHHHHH | 24.41 | 24719451 | |
| 163 | Ubiquitination | YEQILNTKLAEQYES HHHHHHHHHHHHHHH | 44.63 | 29967540 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AKIR1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AKIR1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AKIR1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of AKIR1_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-19; SER-22 AND THR-72,AND MASS SPECTROMETRY. | |
