MARH2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MARH2_HUMAN
• UniProt AC: Q9P0N8
• Protein Name: E3 ubiquitin-protein ligase MARCH2
• Gene Name: 2-Mar
• Organism: Homo sapiens (Human).
• Sequence Length: 246
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein . Lysosome membrane ; Multi-pass membrane protein . Endosome membrane ; Multi-pass membrane protein .
• Protein Description: E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6..
• Protein Sequence: MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
49	Phosphorylation	SRDGRLLSTVIRALD CCCCCHHHHHHHHHC	25.81	27535140
133	Phosphorylation	LKDPGPRTEKRTLCC HCCCCCCCCCHHCCH	49.33	23312004
223	Phosphorylation	LKIREADSPEGPQHS EEEECCCCCCCCCCC	31.72	28060719
230	Phosphorylation	SPEGPQHSPLAAGLL CCCCCCCCHHHHHHH	19.16	28060719

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MARH2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MARH2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MARH2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DLG1_HUMAN	DLG1	physical	17980554
GOPC_HUMAN	GOPC	physical	23818989
STX6_HUMAN	STX6	physical	23818989
CFTR_HUMAN	CFTR	physical	23818989
UBE2H_HUMAN	UBE2H	physical	14722266
UB2R1_HUMAN	CDC34	physical	14722266
UB2D1_HUMAN	UBE2D1	physical	14722266
FATE1_HUMAN	FATE1	physical	25416956
KASH5_HUMAN	CCDC155	physical	25416956
SYNE4_HUMAN	SYNE4	physical	25416956
LRAD1_HUMAN	LDLRAD1	physical	25416956
CFTR_HUMAN	CFTR	physical	27308891

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.