MORN4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MORN4_HUMAN
• UniProt AC: Q8NDC4
• Protein Name: MORN repeat-containing protein 4
• Gene Name: MORN4
• Organism: Homo sapiens (Human).
• Sequence Length: 146
• Subcellular Localization: Cytoplasm . Cell projection, filopodium tip . Cell projection, stereocilium . Found in the cytoplasm in the absence of MYO3A and localizes at filopodial tips in the presence of MYO3A.
• Protein Description: Plays a role in promoting axonal degeneration following neuronal injury by toxic insult or trauma..
• Protein Sequence: MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of MORN4_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MORN4_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MORN4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MORN4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NUTM1_HUMAN	NUTM1	physical	25416956
IN80E_HUMAN	INO80E	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.