UniProt ID | DPPA2_HUMAN | |
---|---|---|
UniProt AC | Q7Z7J5 | |
Protein Name | Developmental pluripotency-associated protein 2 | |
Gene Name | DPPA2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 298 | |
Subcellular Localization | Nucleus . | |
Protein Description | Binds to target gene promoters, including NKX2-5 and SYCE1, but not GATA4, and may be involved in the maintenance of the active epigenetic status of these genes.. | |
Protein Sequence | MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
57 | Sumoylation | VKLEKPKKYNPGHLL CCCCCCCCCCCCCCC | 59.80 | - | |
57 | Sumoylation | VKLEKPKKYNPGHLL CCCCCCCCCCCCCCC | 59.80 | - | |
124 | Dimethylation | EVYLRLHRHAYPEQR EEEHHHHHCCCHHHH | 22.26 | - | |
127 | Phosphorylation | LRLHRHAYPEQRQDM HHHHHCCCHHHHCCC | 10.94 | - | |
138 | Phosphorylation | RQDMPEMSQETRLQR HCCCHHHCHHHHHHH | 24.17 | 24043423 | |
141 | Phosphorylation | MPEMSQETRLQRCSR CHHHCHHHHHHHHHH | 29.10 | 24043423 | |
148 | Dimethylation | TRLQRCSRKRKAVTK HHHHHHHHHHHHHHH | 46.56 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DPPA2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DPPA2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DPPA2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DPPA2_HUMAN | DPPA2 | physical | 16189514 | |
FGF12_HUMAN | FGF12 | physical | 21516116 | |
EIF1A_HUMAN | EIF1AD | physical | 21516116 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...