UniProt ID | FGF12_HUMAN | |
---|---|---|
UniProt AC | P61328 | |
Protein Name | Fibroblast growth factor 12 | |
Gene Name | FGF12 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 243 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in nervous system development and function. Involved in the positive regulation of voltage-gated sodium channel activity. Promotes neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation.. | |
Protein Sequence | MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MAAAIASSLIRQKRQ CHHHHHHHHHHHHHH | 20.85 | 24719451 | |
19 | Phosphorylation | QKRQARESNSDRVSA HHHHHHHCCHHHCCH | 35.76 | 18785766 | |
25 | Phosphorylation | ESNSDRVSASKRRSS HCCHHHCCHHHCCCC | 27.93 | 18785766 | |
50 | Phosphorylation | RHVLGVFSKVRFCSG HHHHHHHHEEEECCC | 28.03 | - | |
150 | Phosphorylation | PECKFKESVFENYYV CCCCCCCHHHCCEEE | 32.47 | 32142685 | |
212 | Phosphorylation | VCMYREPSLHEIGEK EEEECCCCHHHHHHH | 37.29 | 26657352 | |
236 | Acetylation | TPTMNGGKVVNQDST CCCCCCCEEECCCCC | 44.39 | 30588749 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FGF12_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FGF12_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
COIL_HUMAN | COIL | physical | 25416956 | |
IKZF1_HUMAN | IKZF1 | physical | 25416956 | |
ZN460_HUMAN | ZNF460 | physical | 25416956 | |
LZTS2_HUMAN | LZTS2 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...