FGF12_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FGF12_HUMAN
• UniProt AC: P61328
• Protein Name: Fibroblast growth factor 12
• Gene Name: FGF12
• Organism: Homo sapiens (Human).
• Sequence Length: 243
• Subcellular Localization: Nucleus .
• Protein Description: Involved in nervous system development and function. Involved in the positive regulation of voltage-gated sodium channel activity. Promotes neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation..
• Protein Sequence: MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MAAAIASSLIRQKRQ CHHHHHHHHHHHHHH	20.85	24719451
19	Phosphorylation	QKRQARESNSDRVSA HHHHHHHCCHHHCCH	35.76	18785766
25	Phosphorylation	ESNSDRVSASKRRSS HCCHHHCCHHHCCCC	27.93	18785766
50	Phosphorylation	RHVLGVFSKVRFCSG HHHHHHHHEEEECCC	28.03	-
150	Phosphorylation	PECKFKESVFENYYV CCCCCCCHHHCCEEE	32.47	32142685
212	Phosphorylation	VCMYREPSLHEIGEK EEEECCCCHHHHHHH	37.29	26657352
236	Acetylation	TPTMNGGKVVNQDST CCCCCCCEEECCCCC	44.39	30588749

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	SMURF1	Q9HCE7	PMID:20804422

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FGF12_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FGF12_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
COIL_HUMAN	COIL	physical	25416956
IKZF1_HUMAN	IKZF1	physical	25416956
ZN460_HUMAN	ZNF460	physical	25416956
LZTS2_HUMAN	LZTS2	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.