UniProt ID | THAP6_HUMAN | |
---|---|---|
UniProt AC | Q8TBB0 | |
Protein Name | THAP domain-containing protein 6 | |
Gene Name | THAP6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 222 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDVLCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPYHLQGKREKLHCRKNFTLKTVPATNYNHHLVGASSCIEEFQSQFIFEHSYSVMDSPKKLKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDTFCWDCCQESIEQDYIS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
37 | Acetylation | TDENIKRKWVLAMKR CCHHHHHHHHHEEEE | 36.33 | 11504383 | |
56 | Acetylation | AAGIWEPKKGDVLCS CCCCCCCCCCCEEEE | 58.85 | 11504391 | |
166 | Ubiquitination | IGELEDTKESLRNVL HHCHHHHHHHHHHHH | 58.59 | - | |
191 | Ubiquitination | RKTIRELKDECLISQ HHHHHHHHHHHCCCH | 46.88 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THAP6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THAP6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THAP6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KR107_HUMAN | KRTAP10-7 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...