UniProt ID | PRR13_HUMAN | |
---|---|---|
UniProt AC | Q9NZ81 | |
Protein Name | Proline-rich protein 13 | |
Gene Name | PRR13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 148 | |
Subcellular Localization | Nucleus . | |
Protein Description | Negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.. | |
Protein Sequence | MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPGCQPLGPYPPPYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKKMKKAHKKMHKHQKHHKYHKHGKHSSSSSSSSSSDSD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
111 | Acetylation | IVDKKMQKKMKKAHK CCCHHHHHHHHHHHH | 51.87 | 30591579 | |
112 | Acetylation | VDKKMQKKMKKAHKK CCHHHHHHHHHHHHH | 38.77 | 30591585 | |
137 | Phosphorylation | HKHGKHSSSSSSSSS CCCCCCCCCCCCCCC | 33.68 | - | |
138 | Phosphorylation | KHGKHSSSSSSSSSS CCCCCCCCCCCCCCC | 36.94 | - | |
139 | Phosphorylation | HGKHSSSSSSSSSSD CCCCCCCCCCCCCCC | 35.87 | - | |
140 | Phosphorylation | GKHSSSSSSSSSSDS CCCCCCCCCCCCCCC | 35.87 | - | |
141 | Phosphorylation | KHSSSSSSSSSSDSD CCCCCCCCCCCCCCC | 35.87 | - | |
142 | Phosphorylation | HSSSSSSSSSSDSD- CCCCCCCCCCCCCC- | 35.87 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRR13_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRR13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRR13_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KLH12_HUMAN | KLHL12 | physical | 16189514 | |
KR412_HUMAN | KRTAP4-12 | physical | 16189514 | |
PRR13_HUMAN | PRR13 | physical | 25416956 | |
ZCH10_HUMAN | ZCCHC10 | physical | 25416956 | |
VAC14_HUMAN | VAC14 | physical | 25416956 | |
KLH12_HUMAN | KLHL12 | physical | 25416956 | |
LNX1_HUMAN | LNX1 | physical | 25416956 | |
F133A_HUMAN | FAM133A | physical | 25416956 | |
KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
LNX1_HUMAN | LNX1 | physical | 21516116 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...