UniProt ID | PGLR_YEAST | |
---|---|---|
UniProt AC | P47180 | |
Protein Name | Polygalacturonase | |
Gene Name | PGU1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 361 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MISANSLLISTLCAFAIATPLSKRDSCTLTGSSLSSLSTVKKCSSIVIKDLTVPAGQTLDLTGLSSGTTVTFEGTTTFQYKEWSGPLISISGSKISVVGASGHTIDGQGAKWWDGLGDSGKVKPKFVKLALTGTSKVTGLNIKNAPHQVFSINKCSDLTISDITIDIRDGDSAGGHNTDGFDVGSSSNVLIQGCTVYNQDDCIAVNSGSTIKFMNNYCYNGHGISVGSVGGRSDNTVNGFWAENNHVINSDNGLRIKTVEGATGTVTNVNFISNKISGIKSYGIVIEGDYLNSKTTGTATGGVPISNLVMKDITGSVNSTAKRVKILVKNATNWQWSGVSITGGSSYSGCSGIPSGSGASC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
26 | Phosphorylation | TPLSKRDSCTLTGSS CCCCCCCCCCCCCCC | 17.03 | 28889911 | |
28 | Phosphorylation | LSKRDSCTLTGSSLS CCCCCCCCCCCCCHH | 31.16 | 28889911 | |
33 | Phosphorylation | SCTLTGSSLSSLSTV CCCCCCCCHHHHHHH | 33.35 | 28889911 | |
39 | Phosphorylation | SSLSSLSTVKKCSSI CCHHHHHHHEECCEE | 41.45 | 28889911 | |
267 | Phosphorylation | EGATGTVTNVNFISN ECCCCEEEEEEEECC | 33.03 | 28152593 | |
273 | Phosphorylation | VTNVNFISNKISGIK EEEEEEECCCCCCCC | 28.12 | 28152593 | |
277 | Phosphorylation | NFISNKISGIKSYGI EEECCCCCCCCEEEE | 35.75 | 28152593 | |
290 | Phosphorylation | GIVIEGDYLNSKTTG EEEEECCCCCCCCCC | 20.74 | 28889911 | |
298 | Phosphorylation | LNSKTTGTATGGVPI CCCCCCCCCCCCEEH | 20.96 | 28889911 | |
300 | Phosphorylation | SKTTGTATGGVPISN CCCCCCCCCCEEHHH | 34.02 | 28889911 | |
306 | Phosphorylation | ATGGVPISNLVMKDI CCCCEEHHHEEEEEC | 20.31 | 28889911 | |
318 | N-linked_Glycosylation | KDITGSVNSTAKRVK EECCCCCCCHHHEEE | 35.03 | - | |
330 | N-linked_Glycosylation | RVKILVKNATNWQWS EEEEEEECCCCCEEE | 44.51 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PGLR_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PGLR_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PGLR_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ALDH2_YEAST | ALD2 | genetic | 21623372 | |
VRP1_YEAST | VRP1 | genetic | 27708008 | |
ECM33_YEAST | ECM33 | genetic | 27708008 | |
PAT1_YEAST | PAT1 | genetic | 27708008 | |
INO2_YEAST | INO2 | genetic | 27708008 | |
CHO2_YEAST | CHO2 | genetic | 27708008 | |
PANC_YEAST | PAN6 | genetic | 27708008 | |
SWS2_YEAST | SWS2 | genetic | 27708008 | |
YNO0_YEAST | YNL140C | genetic | 27708008 | |
WHI2_YEAST | WHI2 | genetic | 27708008 | |
IRC23_YEAST | IRC23 | genetic | 27708008 | |
TOM6_YEAST | TOM6 | genetic | 27708008 | |
DIA2_YEAST | DIA2 | genetic | 27708008 | |
PALA_YEAST | RIM20 | genetic | 27708008 | |
TGS1_YEAST | TGS1 | genetic | 27708008 | |
KAPB_YEAST | TPK2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...