| UniProt ID | KAPB_YEAST | |
|---|---|---|
| UniProt AC | P06245 | |
| Protein Name | cAMP-dependent protein kinase type 2 | |
| Gene Name | TPK2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 380 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MEFVAERAQPVGQTIQQQNVNTYGQGVLQPHHDLQQRQQQQQQRQHQQLLTSQLPQKSLVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPEEQLDYGIQGDDPYAEYFQDF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEFVAERA -------CCCHHHCC | 9.00 | 22814378 | |
| 64 | Acetylation | KSLVSKGKYTLHDFQ HHHCCCCCEEEHHHE | 38.51 | 24489116 | |
| 78 | Phosphorylation | QIMRTLGTGSFGRVH EHHHEECCCCCCEEE | 32.53 | 22369663 | |
| 80 | Phosphorylation | MRTLGTGSFGRVHLV HHEECCCCCCEEEEE | 25.10 | 22369663 | |
| 220 | Phosphorylation | GFAKEVQTVTWTLCG CCCCEEEEEEEEECC | 25.69 | 22369663 | |
| 222 | Phosphorylation | AKEVQTVTWTLCGTP CCEEEEEEEEECCCC | 19.00 | 22369663 | |
| 224 | Phosphorylation | EVQTVTWTLCGTPDY EEEEEEEEECCCCCE | 11.64 | 22369663 | |
| 228 | Phosphorylation | VTWTLCGTPDYIAPE EEEEECCCCCEECCE | 16.40 | 22369663 | |
| 231 | Phosphorylation | TLCGTPDYIAPEVIT EECCCCCEECCEEEE | 10.53 | 22369663 | |
| 238 | Phosphorylation | YIAPEVITTKPYNKS EECCEEEECCCCCCC | 33.66 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KAPB_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KAPB_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KAPB_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-224, AND MASSSPECTROMETRY. | |
| "Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway."; Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.; Mol. Cell. Proteomics 4:310-327(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-224, AND MASSSPECTROMETRY. | |
