dbPTM

TYW3_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TYW3_YEAST
UniProt AC	P53177
Protein Name	tRNA wybutosine-synthesizing protein 3
Gene Name	TYW3
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	273
Subcellular Localization
Protein Description	S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Probably methylates N-4 position of wybutosine-86 to produce wybutosine-72..
Protein Sequence	MAAQNAFEQKKRAILNEIDSTQPDLSPKGTIDELCLPIIDLINASADMVTTSSCSGRVSVFLEGTKSYNGEVKIGGKGQGGKWLYVTHDREKVIGWLDELKSKSEFSFELSGKEIPTEKVTGSIRYILYKYEPFILHVKCRDFQAASKLYNTAMSCGFRESGIGSNNLVAIRINIKLDVPLGYLDETSGTLKFFVTPEYVSVLDSLSLSKFDENTRKMQALYDRIEKELINCAPDVNSKVNITPIETKEERRERKKREGMERQRQLKSPQNVL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
26	Phosphorylation	DSTQPDLSPKGTIDE HCCCCCCCCCCCHHH	31.76	25752575
101	Acetylation	IGWLDELKSKSEFSF EEHHHHHHCCCCEEE	54.51	24489116
238	Phosphorylation	NCAPDVNSKVNITPI HCCCCCCCCCCCCCC	37.52	28889911
243	Phosphorylation	VNSKVNITPIETKEE CCCCCCCCCCCCHHH	17.01	27017623
248	Acetylation	NITPIETKEERRERK CCCCCCCHHHHHHHH	44.80	24489116
268	Phosphorylation	ERQRQLKSPQNVL-- HHHHHHCCCCCCC--	40.07	28152593

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TYW3_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TYW3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TYW3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GEA1_YEAST	GEA1	physical	16554755
CND2_YEAST	BRN1	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
TAD3_YEAST	TAD3	genetic	27708008
CLP1_YEAST	CLP1	genetic	27708008
MED20_YEAST	SRB2	genetic	27708008
MMS22_YEAST	MMS22	genetic	27708008
VRP1_YEAST	VRP1	genetic	27708008
FKS1_YEAST	FKS1	genetic	27708008
MAK5_YEAST	MAK5	genetic	27708008
CDC48_YEAST	CDC48	genetic	27708008
NOP14_YEAST	NOP14	genetic	27708008
PDC2_YEAST	PDC2	genetic	27708008
SEC7_YEAST	SEC7	genetic	27708008
ERF3_YEAST	SUP35	genetic	27708008
CDC1_YEAST	CDC1	genetic	27708008
SNU56_YEAST	SNU56	genetic	27708008
SMT3_YEAST	SMT3	genetic	27708008
RSP5_YEAST	RSP5	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
FIP1_YEAST	FIP1	genetic	27708008
FNTA_YEAST	RAM2	genetic	27708008
RNA1_YEAST	RNA1	genetic	27708008
LCB1_YEAST	LCB1	genetic	27708008
NUF2_YEAST	NUF2	genetic	27708008
CH10_YEAST	HSP10	genetic	27708008
TYSY_YEAST	CDC21	genetic	27708008
SEC63_YEAST	SEC63	genetic	27708008
COPZ_YEAST	RET3	genetic	27708008
NAB3_YEAST	NAB3	genetic	27708008
HRR25_YEAST	HRR25	genetic	27708008
NIP7_YEAST	NIP7	genetic	27708008
ECM13_YEAST	ECM13	genetic	27708008
YBM6_YEAST	YBR016W	genetic	27708008
SEC66_YEAST	SEC66	genetic	27708008
RS6A_YEAST	RPS6B	genetic	27708008
RS6B_YEAST	RPS6B	genetic	27708008
HBT1_YEAST	HBT1	genetic	27708008
GCS1_YEAST	GCS1	genetic	27708008
OST4_YEAST	OST4	genetic	27708008
PP4C_YEAST	PPH3	genetic	27708008
RV167_YEAST	RVS167	genetic	27708008
AIM11_YEAST	AIM11	genetic	27708008
RS26B_YEAST	RPS26B	genetic	27708008
DDI1_YEAST	DDI1	genetic	27708008
YGY5_YEAST	YGL235W	genetic	27708008
RTF1_YEAST	RTF1	genetic	27708008
METW_YEAST	YLL058W	genetic	27708008
MHT1_YEAST	MHT1	genetic	27708008
RSSA2_YEAST	RPS0B	genetic	27708008
CSF1_YEAST	CSF1	genetic	27708008
SRN2_YEAST	SRN2	genetic	27708008
YL225_YEAST	YLR225C	genetic	27708008
FMP27_YEAST	FMP27	genetic	27708008
SPO20_YEAST	SPO20	genetic	27708008
MGR3_YEAST	MGR3	genetic	27708008
LCF4_YEAST	FAA4	genetic	27708008
GAS1_YEAST	GAS1	genetic	27708008
YN94_YEAST	YNR065C	genetic	27708008
VAM3_YEAST	VAM3	genetic	27708008
SUR1_YEAST	SUR1	genetic	27708008
WDR6_YEAST	RTT10	genetic	27708008
YAR1_YEAST	YAR1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TYW3_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-26, AND MASSSPECTROMETRY.	18407956 [Abstract]