UniProt ID | PHM6_YEAST | |
---|---|---|
UniProt AC | Q05637 | |
Protein Name | Phosphate metabolism protein 6 | |
Gene Name | PHM6 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 104 | |
Subcellular Localization |
Vacuole membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MEDTSRCIDDVLKIGQQEKEIRQAEFSDAQGEREEVKCIDYTVDLEAGLPRHESSGKSNTLKQCYNAVLGFLEELIIVIIIVLLLYSLTMVGLFYVMTMTKFLF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PHM6_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PHM6_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PHM6_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PHM6_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MCFS2_YEAST | EHT1 | genetic | 27708008 | |
NHP10_YEAST | NHP10 | genetic | 27708008 | |
RLA1_YEAST | RPP1A | genetic | 27708008 | |
RAD4_YEAST | RAD4 | genetic | 27708008 | |
ODPA_YEAST | PDA1 | genetic | 27708008 | |
PEF1_YEAST | PEF1 | genetic | 27708008 | |
ICE2_YEAST | ICE2 | genetic | 27708008 | |
GST1_YEAST | GTT1 | genetic | 27708008 | |
CWP2_YEAST | CWP2 | genetic | 27708008 | |
FEN1_YEAST | RAD27 | genetic | 27708008 | |
UBX2_YEAST | UBX2 | genetic | 27708008 | |
VPS9_YEAST | VPS9 | genetic | 27708008 | |
GPD2_YEAST | GPD2 | genetic | 27708008 | |
INO4_YEAST | INO4 | genetic | 27708008 | |
MSC6_YEAST | MSC6 | genetic | 27708008 | |
ELP3_YEAST | ELP3 | genetic | 27708008 | |
HSP7F_YEAST | SSE1 | genetic | 27708008 | |
PRAF1_HUMAN | RABAC1 | physical | 27107014 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...