| UniProt ID | ELOC_YEAST | |
|---|---|---|
| UniProt AC | Q03071 | |
| Protein Name | Elongin-C | |
| Gene Name | ELC1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 99 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Prevents degradation of interacting proteins like PCL6 by the proteasome.. | |
| Protein Sequence | MSQDFVTLVSKDDKEYEISRSAAMISPTLKAMIEGPFRESKGRIELKQFDSHILEKAVEYLNYNLKYSGVSEDDDEIPEFEIPTEMSLELLLAADYLSI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSQDFVTLV ------CCCCCEEEE | 38.16 | 22814378 | |
| 2 | Phosphorylation | ------MSQDFVTLV ------CCCCCEEEE | 38.16 | 22369663 | |
| 7 | Phosphorylation | -MSQDFVTLVSKDDK -CCCCCEEEEECCCC | 22.80 | 22369663 | |
| 26 | Phosphorylation | SRSAAMISPTLKAMI CHHHHHHCHHHHHHH | 9.96 | 19779198 | |
| 28 | Phosphorylation | SAAMISPTLKAMIEG HHHHHCHHHHHHHHC | 33.82 | 19779198 | |
| 60 | Phosphorylation | ILEKAVEYLNYNLKY HHHHHHHHHHHCCEE | 8.14 | 22369663 | |
| 63 | Phosphorylation | KAVEYLNYNLKYSGV HHHHHHHHCCEECCC | 21.19 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ELOC_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ELOC_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ELOC_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...