| UniProt ID | PAD1_YEAST | |
|---|---|---|
| UniProt AC | P33751 | |
| Protein Name | Flavin prenyltransferase PAD1, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03197, ECO:0000305} | |
| Gene Name | PAD1 {ECO:0000255|HAMAP-Rule:MF_03197, ECO:0000303|PubMed:8181743} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 242 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Flavin prenyltransferase that catalyzes the synthesis of the prenylated FMN cofactor (prenyl-FMN) for the ferulic acid decarboxylase FDC1/ubiD. [PubMed: 25647642 The prenyltransferase is metal-independent and links a dimethylallyl moiety from dimethylallyl monophosphate (DMAP) to the flavin N5 and C6 atoms of FMN (By similarity Involved in the decarboxylation of phenylacrylic acids like ferulic acid, p-coumaric acid or cinnamic acid, producing the corresponding vinyl derivatives which play the role of aroma metabolites. Also involved in the degradation of the food preservative sorbic acid (2,4-hexadienoic acid) to a volatile hydrocarbon, 1,3-pentadiene. Not essential for ubiquinone synthesis] | |
| Protein Sequence | MLLFPRRTNIAFFKTTGIFANFPLLGRTITTSPSFLTHKLSKEVTRASTSPPRPKRIVVAITGATGVALGIRLLQVLKELSVETHLVISKWGAATMKYETDWEPHDVAALATKTYSVRDVSACISSGSFQHDGMIVVPCSMKSLAAIRIGFTEDLITRAADVSIKENRKLLLVTRETPLSSIHLENMLSLCRAGVIIFPPVPAFYTRPKSLHDLLEQSVGRILDCFGIHADTFPRWEGIKSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of PAD1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAD1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAD1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAD1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UBC7_YEAST | UBC7 | physical | 22204397 | |
| YBC9_YEAST | YBL029W | genetic | 27708008 | |
| MTU1_YEAST | SLM3 | genetic | 27708008 | |
| CGR1_YEAST | CGR1 | genetic | 27708008 | |
| ASK10_YEAST | ASK10 | genetic | 27708008 | |
| FRA1_YEAST | FRA1 | genetic | 27708008 | |
| COQ7_YEAST | CAT5 | genetic | 27708008 | |
| IMG2_YEAST | IMG2 | genetic | 27708008 | |
| S2538_YEAST | YDL119C | genetic | 27708008 | |
| UBC13_YEAST | UBC13 | genetic | 27708008 | |
| SPO71_YEAST | SPO71 | genetic | 27708008 | |
| MET10_YEAST | MET10 | genetic | 27708008 | |
| POG1_YEAST | POG1 | genetic | 27708008 | |
| VPS53_YEAST | VPS53 | genetic | 27708008 | |
| IF4A_YEAST | TIF2 | genetic | 27708008 | |
| COX12_YEAST | COX12 | genetic | 27708008 | |
| ACE2_YEAST | ACE2 | genetic | 27708008 | |
| YL352_YEAST | YLR352W | genetic | 27708008 | |
| GAL80_YEAST | GAL80 | genetic | 27708008 | |
| RSF1_YEAST | RSF1 | genetic | 27708008 | |
| COQ2_YEAST | COQ2 | genetic | 27708008 | |
| PHO80_YEAST | PHO80 | genetic | 27708008 | |
| PT127_YEAST | PET127 | genetic | 27708008 | |
| BECN1_YEAST | VPS30 | genetic | 27708008 | |
| RTC6_YEAST | RTC6 | genetic | 27708008 | |
| NEW1_YEAST | NEW1 | genetic | 27708008 | |
| PLR1_YEAST | YPR127W | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...