dbPTM

POF1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	POF1_YEAST
UniProt AC	P25576
Protein Name	Nicotinamide mononucleotide adenylyltransferase {ECO:0000303\|PubMed:24759102}
Gene Name	POF1 {ECO:0000303\|PubMed:21460040}
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	258
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. Involved in the salvage pathway for NAD(+) biosynthesis via NMN. [PubMed: 24759102 Involved in the filamentation pathway. Suppresses the filamentation defect of a KSS1 deletion]
Protein Sequence	MKKTFEQFRKSNLLFQVLKGPQHLECQKLFVLDSSFNPPHLAHFQLLSQTIKNFKLKDTRSHVLLLLAVNNADKLPKPASFPTRLEMMCLFADYLQEKLPQSVVSVGLTVFSKFIDKDKILHEQFVKGCSADIGYLVGFDTIARIFDEKYYHPLKISDVMESFMSGSQLYCLARGDCHLSAESQLRYASDILEGKFEPVIPREWGARIHVMQNDYPALRNVSSSEIRNKLKNGQVESLKDELPLCIYDYLINNKTIFD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
102	Phosphorylation	LQEKLPQSVVSVGLT HHHHCCCCHHHHCCE	23.65	22369663
105	Phosphorylation	KLPQSVVSVGLTVFS HCCCCHHHHCCEEHH	14.33	22369663
109	Phosphorylation	SVVSVGLTVFSKFID CHHHHCCEEHHHHCC	17.36	22369663
112	Phosphorylation	SVGLTVFSKFIDKDK HHCCEEHHHHCCHHH	23.48	22369663
149	Acetylation	IARIFDEKYYHPLKI HHHHHCCCCCCCCCH	53.61	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of POF1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of POF1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of POF1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KSS1_YEAST	KSS1	physical	21460040
LCB2_YEAST	LCB2	genetic	27708008
CDC37_YEAST	CDC37	genetic	27708008
TCPZ_YEAST	CCT6	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
NU159_YEAST	NUP159	genetic	27708008
BOS1_YEAST	BOS1	genetic	27708008
LIP1_YEAST	LIP1	genetic	27708008
CDC24_YEAST	CDC24	genetic	27708008
STU1_YEAST	STU1	genetic	27708008
TAF5_YEAST	TAF5	genetic	27708008
MCM7_YEAST	MCM7	genetic	27708008
PRP9_YEAST	PRP9	genetic	27708008
CDC53_YEAST	CDC53	genetic	27708008
CWC2_YEAST	CWC2	genetic	27708008
TIM22_YEAST	TIM22	genetic	27708008
TAF12_YEAST	TAF12	genetic	27708008
SCC2_YEAST	SCC2	genetic	27708008
GPI8_YEAST	GPI8	genetic	27708008
TBP_YEAST	SPT15	genetic	27708008
CDC4_YEAST	CDC4	genetic	27708008
RSC8_YEAST	RSC8	genetic	27708008
PRS8_YEAST	RPT6	genetic	27708008
CDC20_YEAST	CDC20	genetic	27708008
SMD1_YEAST	SMD1	genetic	27708008
SYNC_YEAST	DED81	genetic	27708008
PRP21_YEAST	PRP21	genetic	27708008
CDC45_YEAST	CDC45	genetic	27708008
POB3_YEAST	POB3	genetic	27708008
MCM1_YEAST	MCM1	genetic	27708008
RPC6_YEAST	RPC34	genetic	27708008
PSA4_YEAST	PRE6	genetic	27708008
TPT1_YEAST	TPT1	genetic	27708008
GRPE_YEAST	MGE1	genetic	27708008
MOT1_YEAST	MOT1	genetic	27708008
TF2B_YEAST	SUA7	genetic	27708008
PSB5_YEAST	PRE2	genetic	27708008
RPC3_YEAST	RPC82	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of POF1_YEAST

Related Literatures of Post-Translational Modification