UniProt ID | YP114_YEAST | |
---|---|---|
UniProt AC | Q06107 | |
Protein Name | Uncharacterized TLC domain-containing protein YPR114W | |
Gene Name | YPR114W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 315 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MDVLLSLPQPELFKTTVIPFLANRNIIKSEAILSNLHSIFYVAIFYHIWFLFGKWILFPHLVKWKLDYDQKHNVKKDEKTTSERQAQHYKKKYTSLINQSSVHLISLLQSIVVLYYSLKFLLDPKASAEPYQTSHSRVFTENRDTQVICIFAIGYFVWDIYISTMYSTFPFVVHGIISTVVFCIGLKPYIQYYAPVFLMFELSNPSLNFRWFGIKFLPQKSKFCSLLLLLNNLTLMVVFFAARIAWGWFQIGKLCYDFYQVRNEPGFLVFDTIVILAGNFVLDILNVIWFSTMVSVAAKVLKKGESVDKVTKNEQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YP114_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YP114_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YP114_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SEC5_YEAST | SEC5 | physical | 16554755 | |
HEL2_YEAST | HEL2 | physical | 16554755 | |
DYL1_YEAST | DYN2 | genetic | 16269340 | |
YPR71_YEAST | YPR071W | genetic | 16269340 | |
MON2_YEAST | MON2 | genetic | 16269340 | |
RGP1_YEAST | RGP1 | genetic | 16269340 | |
RIC1_YEAST | RIC1 | genetic | 16269340 | |
SSB1_YEAST | SSB1 | physical | 22940862 | |
HSP71_YEAST | SSA1 | physical | 22940862 | |
MBA1_YEAST | MBA1 | genetic | 27708008 | |
ATC1_YEAST | PMR1 | genetic | 27708008 | |
CHO2_YEAST | CHO2 | genetic | 27708008 | |
SNF6_YEAST | SNF6 | genetic | 27708008 | |
DCOR_YEAST | SPE1 | genetic | 27708008 | |
VRP1_YEAST | VRP1 | genetic | 27708008 | |
BUL2_YEAST | BUL2 | genetic | 27708008 | |
SIN3_YEAST | SIN3 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...