| UniProt ID | YAP7_YEAST | |
|---|---|---|
| UniProt AC | Q08182 | |
| Protein Name | AP-1-like transcription factor YAP7 | |
| Gene Name | YAP7 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 245 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Probable transcription activator linked to cell cycle that induces transcription activation of genes in the environmental stress response and metabolism control pathways, like the closely related YAP5.. | |
| Protein Sequence | MRQRRSVVAVSVKPKGFKLGHKQGSMSTTSPPPSSPDGNVSTSGPSAIKLSKNWELPQRLKPGRKPKSKRGDASANNDGSSKIKKVQTSNQKDQMTTKDHENEGAKGHEGKSDDEGNGSGDENGVDSVEKRRRQNRDAQRAYRERRTTRIQVLEEKVEMLHNLVDDWQRKYKLLESEFSDTKENLQKSIALNNELQKALPLIVNTPFQQQPENPPDNPISILEMVENFKPIGAVSLKKGKLKAHC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 27 | Phosphorylation | GHKQGSMSTTSPPPS CCCCCCCCCCCCCCC | 30.17 | 23749301 | |
| 34 | Phosphorylation | STTSPPPSSPDGNVS CCCCCCCCCCCCCCC | 61.34 | 23749301 | |
| 35 | Phosphorylation | TTSPPPSSPDGNVST CCCCCCCCCCCCCCC | 32.55 | 23749301 | |
| 74 | Phosphorylation | KSKRGDASANNDGSS CCCCCCCCCCCCCCH | 35.95 | 19779198 | |
| 80 | Phosphorylation | ASANNDGSSKIKKVQ CCCCCCCCHHHEECE | 31.18 | 19779198 | |
| 112 | Phosphorylation | AKGHEGKSDDEGNGS CCCCCCCCCCCCCCC | 62.24 | 28889911 | |
| 119 | Phosphorylation | SDDEGNGSGDENGVD CCCCCCCCCCCCCCH | 47.25 | 28889911 | |
| 127 | Phosphorylation | GDENGVDSVEKRRRQ CCCCCCHHHHHHHHH | 29.75 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YAP7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YAP7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YAP7_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PGPS1_YEAST | PGS1 | physical | 16554755 | |
| SMK1_YEAST | SMK1 | physical | 16554755 | |
| SGF73_YEAST | SGF73 | genetic | 20959818 | |
| BUB1_YEAST | BUB1 | genetic | 21127252 | |
| KCS1_YEAST | KCS1 | genetic | 21127252 | |
| REI1_YEAST | REI1 | genetic | 21127252 | |
| RTG3_YEAST | RTG3 | genetic | 21127252 | |
| MET18_YEAST | MET18 | genetic | 21127252 | |
| PACC_YEAST | RIM101 | genetic | 21127252 | |
| RXT2_YEAST | RXT2 | genetic | 21127252 | |
| CHA4_YEAST | CHA4 | genetic | 21127252 | |
| BCK1_YEAST | BCK1 | genetic | 21127252 | |
| GAT2_YEAST | GAT2 | genetic | 21127252 | |
| VPS71_YEAST | VPS71 | genetic | 21127252 | |
| SYSM_YEAST | DIA4 | physical | 22875988 | |
| CASP_YEAST | COY1 | physical | 22875988 | |
| MDM1_YEAST | MDM1 | physical | 22875988 | |
| NIP80_YEAST | NIP100 | physical | 22875988 | |
| YAP7_YEAST | YAP7 | physical | 23661758 | |
| FZF1_YEAST | FZF1 | genetic | 25732006 | |
| TUP1_YEAST | TUP1 | physical | 25732006 | |
| TPO2_YEAST | TPO2 | genetic | 27708008 | |
| CHO2_YEAST | CHO2 | genetic | 27708008 | |
| SNF6_YEAST | SNF6 | genetic | 27708008 | |
| YM35_YEAST | YMR160W | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...