YHC6_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YHC6_YEAST
• UniProt AC: P38740
• Protein Name: Uncharacterized protein YHL026C
• Gene Name: YHL026C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 315
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MKSSEPAPATPTGFRNSIWFIIFYLFVIQALGSAIISGGIEFAIAYAMYHSRVDLITLWAFPHTISGDCALSLFIQVGLTWASEEILVGFDDYKRPVFRLNKWITKPSPLKTESNEEIPPPKKRFIVDYFESKDNVVAKQNTLYHKHNWLFGYLEVNRGIIPKGKEATLKGFLTSQFIHDSTQSKFMNFIEWFVQKFIRSMILAIAMFIVIWPVTMGILAGIGHKVGSHDYYFNDYPLPQVMKLIYAVVIAFVCTPVAIIVIVLRNQFHEELYYEGLANGTLQQDQEVCSTGNRSSGSTDQDISTTKQQSQEAVA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
108	Phosphorylation	NKWITKPSPLKTESN CCCCCCCCCCCCCCC	44.41	19795423
295	Phosphorylation	VCSTGNRSSGSTDQD HHCCCCCCCCCCCCC	42.95	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YHC6_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YHC6_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YHC6_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SSB1_YEAST	SSB1	physical	22940862
GPR1_YEAST	GPR1	genetic	27708008
BUD31_YEAST	BUD31	genetic	27708008
VMA21_YEAST	VMA21	genetic	27708008
SDS3_YEAST	SDS3	genetic	27708008
FLX1_YEAST	FLX1	genetic	27708008
ASF1_YEAST	ASF1	genetic	27708008
MOG1_YEAST	MOG1	genetic	27708008
SIC1_YEAST	SIC1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.