UniProt ID | CRG1_YEAST | |
---|---|---|
UniProt AC | P38892 | |
Protein Name | Probable S-adenosylmethionine-dependent methyltransferase CRG1 | |
Gene Name | CRG1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 291 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Probable S-adenosylmethionine-dependent methyltransferase which mediates cantharidin resistance.. | |
Protein Sequence | MPKTSYLNKNFESAHYNNVRPSYPLSLVNEIMKFHKGTRKSLVDIGCGTGKATFVVEPYFKEVIGIDPSSAMLSIAEKETNERRLDKKIRFINAPGEDLSSIRPESVDMVISAEAIHWCNLERLFQQVSSILRSDGTFAFWFYIQPEFVDFPEALNVYYKYGWSKDYMGKYLNDNQREILLNYGGEKLRSLLSDRFGDIEVTIYSPSDPNASTVTAENSQFLWRAAITLNQFKEFVKSWSIYTSWARDNPSKPDIADIFINELKEICHCEDLNVPLKIEWSTFYYLCRKRE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Ubiquitination | KFHKGTRKSLVDIGC HHCCCCCCCCEEECC | 48.24 | 17644757 | |
41 | Phosphorylation | FHKGTRKSLVDIGCG HCCCCCCCCEEECCC | 30.27 | 23749301 | |
51 | Ubiquitination | DIGCGTGKATFVVEP EECCCCCCEEEEEEC | 44.05 | 17644757 | |
187 | Ubiquitination | LLNYGGEKLRSLLSD HHHCCHHHHHHHHHH | 53.10 | 23749301 | |
237 | Ubiquitination | NQFKEFVKSWSIYTS HHHHHHHHHHHHHHH | 52.07 | 17644757 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRG1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRG1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRG1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...