dbPTM

ERJ5_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ERJ5_YEAST
UniProt AC	P43613
Protein Name	ER-localized J domain-containing protein 5
Gene Name	ERJ5
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	295
Subcellular Localization	Endoplasmic reticulum membrane Single-pass type I membrane protein .
Protein Description	DnaJ-like chaperone required for the folding capacity of the endoplasmic reticulum..
Protein Sequence	MNGYWKPALVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKGGFYFSRMKPKTWFLLAFIWIVVNIGQYIISIIQYRSQRSRIENFISQCKQQDDTNGLGVKQLTFKQHEKDEGKSLVVRFSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMTFGKSVGSAGKEEIITDSKKYDGNQTKKGNKVKKGSAKKGQKKMELPNGKVIYSRK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
169	Ubiquitination	ENFISQCKQQDDTNG HHHHHHHHHCCCCCC	43.27	23749301
200	Phosphorylation	KSLVVRFSDVYVVEP CEEEEEEEEEEEECC	18.66	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ERJ5_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ERJ5_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ERJ5_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SEC63_YEAST	SEC63	genetic	16269340
SEC62_YEAST	SEC62	genetic	16269340
PLMT_YEAST	OPI3	genetic	16269340
GRP78_YEAST	KAR2	genetic	17157937
JEM1_YEAST	JEM1	genetic	17157937
SCJ1_YEAST	SCJ1	genetic	17157937
IRE1_YEAST	IRE1	genetic	17157937
ADH4_YEAST	ADH4	physical	18467557
SIL1_YEAST	SIL1	genetic	19325107

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ERJ5_YEAST

Related Literatures of Post-Translational Modification