UniProt ID | MRX3_YEAST | |
---|---|---|
UniProt AC | P38172 | |
Protein Name | MIOREX complex component 3 {ECO:0000305|PubMed:25683707} | |
Gene Name | MRX3 {ECO:0000303|PubMed:25683707} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 270 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Component of MIOREX complexes, large expressome-like assemblies of ribosomes with factors involved in all the steps of post-transcriptional gene expression.. | |
Protein Sequence | MSRTIPFLFKLVNRAVILPTAGFTLGVGAFVKAWPDDAGVLSLNDPQTPAELISATKSRQPMELQRVDILAQIEKSEVYNKLAQDEKMHHVLFSEKIPSGHREYHVGQGLLFGKGKLEIDPLVFHDVNHGELTVIYHLGAELGNRDGNVHKGLLSLLLDEALCYCGFPLLPSKRGVTARLSLEFFEDIPVDTTIILKANVKEIKGRKCIIEGHLEQFPLEVSSRNGTRSWNLPHIWGFNHKQEMAKKFAKANCILVEPTWFKYFKWLDMF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
42 | Phosphorylation | PDDAGVLSLNDPQTP CCCCCEECCCCCCCH | 27214570 | ||
48 | Phosphorylation | LSLNDPQTPAELISA ECCCCCCCHHHHHHH | 27214570 | ||
54 | Phosphorylation | QTPAELISATKSRQP CCHHHHHHHCCCCCC | 27214570 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MRX3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MRX3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MRX3_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NPL4_YEAST | NPL4 | genetic | 27708008 | |
RMD9L_YEAST | YBR238C | genetic | 27708008 | |
RS29B_YEAST | RPS29B | genetic | 27708008 | |
FMP16_YEAST | FMP16 | genetic | 27708008 | |
STP1_YEAST | STP1 | genetic | 27708008 | |
NKP2_YEAST | NKP2 | genetic | 27708008 | |
SOK2_YEAST | SOK2 | genetic | 27708008 | |
IMP2_YEAST | IMP2 | genetic | 27708008 | |
PUB1_YEAST | PUB1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...