| UniProt ID | MRX3_YEAST | |
|---|---|---|
| UniProt AC | P38172 | |
| Protein Name | MIOREX complex component 3 {ECO:0000305|PubMed:25683707} | |
| Gene Name | MRX3 {ECO:0000303|PubMed:25683707} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 270 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Component of MIOREX complexes, large expressome-like assemblies of ribosomes with factors involved in all the steps of post-transcriptional gene expression.. | |
| Protein Sequence | MSRTIPFLFKLVNRAVILPTAGFTLGVGAFVKAWPDDAGVLSLNDPQTPAELISATKSRQPMELQRVDILAQIEKSEVYNKLAQDEKMHHVLFSEKIPSGHREYHVGQGLLFGKGKLEIDPLVFHDVNHGELTVIYHLGAELGNRDGNVHKGLLSLLLDEALCYCGFPLLPSKRGVTARLSLEFFEDIPVDTTIILKANVKEIKGRKCIIEGHLEQFPLEVSSRNGTRSWNLPHIWGFNHKQEMAKKFAKANCILVEPTWFKYFKWLDMF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 42 | Phosphorylation | PDDAGVLSLNDPQTP CCCCCEECCCCCCCH | 27214570 | ||
| 48 | Phosphorylation | LSLNDPQTPAELISA ECCCCCCCHHHHHHH | 27214570 | ||
| 54 | Phosphorylation | QTPAELISATKSRQP CCHHHHHHHCCCCCC | 27214570 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MRX3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MRX3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MRX3_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NPL4_YEAST | NPL4 | genetic | 27708008 | |
| RMD9L_YEAST | YBR238C | genetic | 27708008 | |
| RS29B_YEAST | RPS29B | genetic | 27708008 | |
| FMP16_YEAST | FMP16 | genetic | 27708008 | |
| STP1_YEAST | STP1 | genetic | 27708008 | |
| NKP2_YEAST | NKP2 | genetic | 27708008 | |
| SOK2_YEAST | SOK2 | genetic | 27708008 | |
| IMP2_YEAST | IMP2 | genetic | 27708008 | |
| PUB1_YEAST | PUB1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...