| UniProt ID | FMP16_YEAST | |
|---|---|---|
| UniProt AC | Q12497 | |
| Protein Name | Protein FMP16, mitochondrial | |
| Gene Name | FMP16 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 93 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | ||
| Protein Sequence | MLRTTFLRTPRQLMRKSPRASFSIVTRAAFPHLKNNQDEAEKKEQGLFDSNKKRLDTLEHGKNPDYKQPGMEDLKKKGDDARIEQNRPDDGVY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FMP16_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FMP16_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FMP16_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GNA1_YEAST | GNA1 | physical | 10688190 | |
| BEM1_YEAST | BEM1 | genetic | 20093466 | |
| PHB2_YEAST | PHB2 | genetic | 20093466 | |
| TOM70_YEAST | TOM70 | genetic | 20093466 | |
| RL22A_YEAST | RPL22A | genetic | 27708008 | |
| RSP5_YEAST | RSP5 | genetic | 27708008 | |
| DPB11_YEAST | DPB11 | genetic | 27708008 | |
| CDC11_YEAST | CDC11 | genetic | 27708008 | |
| MED14_YEAST | RGR1 | genetic | 27708008 | |
| MED10_YEAST | NUT2 | genetic | 27708008 | |
| ATG1_YEAST | ATG1 | genetic | 27708008 | |
| PHB2_YEAST | PHB2 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...