UniProt ID | FMP16_YEAST | |
---|---|---|
UniProt AC | Q12497 | |
Protein Name | Protein FMP16, mitochondrial | |
Gene Name | FMP16 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 93 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MLRTTFLRTPRQLMRKSPRASFSIVTRAAFPHLKNNQDEAEKKEQGLFDSNKKRLDTLEHGKNPDYKQPGMEDLKKKGDDARIEQNRPDDGVY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FMP16_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FMP16_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FMP16_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GNA1_YEAST | GNA1 | physical | 10688190 | |
BEM1_YEAST | BEM1 | genetic | 20093466 | |
PHB2_YEAST | PHB2 | genetic | 20093466 | |
TOM70_YEAST | TOM70 | genetic | 20093466 | |
RL22A_YEAST | RPL22A | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
DPB11_YEAST | DPB11 | genetic | 27708008 | |
CDC11_YEAST | CDC11 | genetic | 27708008 | |
MED14_YEAST | RGR1 | genetic | 27708008 | |
MED10_YEAST | NUT2 | genetic | 27708008 | |
ATG1_YEAST | ATG1 | genetic | 27708008 | |
PHB2_YEAST | PHB2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...