UniProt ID | YD391_YEAST | |
---|---|---|
UniProt AC | Q04170 | |
Protein Name | Uncharacterized protein YDR391C | |
Gene Name | YDR391C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 232 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | ||
Protein Sequence | MSFENKLPTPLENNDAKGHMVCTLNKTTDARRAAETLSIAFSNSPAFHFICKKILNIPLAEKVPTRTITTDIISPFLDSPYGEISEVNTFDAVAVWSLPPHVPKARSNDAKFNKDFIDDLNARVKQVIPNGINYYYLFCIGKNLNEKGIRGSVRTIFEEYKRRADEENCAIVLEAIAEHAKSVYEYFGFRNYMTFKYGECEVDSNGNCDPNGEGFTAYLMIYHKDGNKVLKE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSFENKLPT ------CCCCCCCCC | 41.07 | 22369663 | |
6 | Acetylation | --MSFENKLPTPLEN --CCCCCCCCCCCCC | 48.96 | 25381059 | |
9 | Phosphorylation | SFENKLPTPLENNDA CCCCCCCCCCCCCCC | 51.44 | 22369663 | |
26 | Acetylation | HMVCTLNKTTDARRA CEEEEECCCHHHHHH | 56.78 | 22865919 | |
62 | Acetylation | LNIPLAEKVPTRTIT HCCCHHHCCCCCEEE | 48.16 | 24489116 | |
111 | Acetylation | KARSNDAKFNKDFID CCCCCCCCCCHHHHH | 52.94 | 24489116 | |
114 | Acetylation | SNDAKFNKDFIDDLN CCCCCCCHHHHHHHH | 58.09 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YD391_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YD391_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YD391_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...