UniProt ID | CYSD_YEAST | |
---|---|---|
UniProt AC | P06106 | |
Protein Name | Homocysteine/cysteine synthase {ECO:0000305} | |
Gene Name | MET17 {ECO:0000303|PubMed:8511969} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 444 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Catalyzes the conversion of O-acetyl-L-homoserine (OAH) into homocysteine in the methionine biosynthesis pathway. Also catalyzes the conversion of O-acetylserine (OAS) into cysteine, the last step in the cysteine biosynthesis pathway. [PubMed: 7765825] | |
Protein Sequence | MPSHFDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSKHGSQLFGLEVPGYVYSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKWLEQSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEFIDDIIADFQQSFETVFAGQKP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Phosphorylation | RSRAVPIYATTSYVF CCCCCCEEEEEEEEE | 28889911 | ||
32 | Phosphorylation | RAVPIYATTSYVFEN CCCCEEEEEEEEEEC | 30377154 | ||
33 | Phosphorylation | AVPIYATTSYVFENS CCCEEEEEEEEEECC | 30377154 | ||
34 | Phosphorylation | VPIYATTSYVFENSK CCEEEEEEEEEECCC | 28152593 | ||
35 | Phosphorylation | PIYATTSYVFENSKH CEEEEEEEEEECCCC | 25752575 | ||
41 | Ubiquitination | SYVFENSKHGSQLFG EEEEECCCCCHHEEC | 17644757 | ||
44 | Phosphorylation | FENSKHGSQLFGLEV EECCCCCHHEECEEC | 17330950 | ||
63 | Phosphorylation | YSRFQNPTSNVLEER EECCCCCCCCHHHHH | 28889911 | ||
142 | Acetylation | DNPEEFEKVFDERTK CCHHHHHHHHCCCCC | 24489116 | ||
142 | Ubiquitination | DNPEEFEKVFDERTK CCHHHHHHHHCCCCC | 17644757 | ||
160 | Ubiquitination | LETIGNPKYNVPDFE EEECCCCCCCCCCHH | 23749301 | ||
160 | Acetylation | LETIGNPKYNVPDFE EEECCCCCCCCCCHH | 24489116 | ||
168 | Acetylation | YNVPDFEKIVAIAHK CCCCCHHHHHHHHHH | 24489116 | ||
175 | Ubiquitination | KIVAIAHKHGIPVVV HHHHHHHHHCCCEEE | 17644757 | ||
197 | Ubiquitination | GYFCQPIKYGADIVT CCCCCEECCCCEEEE | 17644757 | ||
206 | Phosphorylation | GADIVTHSATKWIGG CCEEEEEECCCCCCC | 21440633 | ||
209 | Other | IVTHSATKWIGGHGT EEEEECCCCCCCCCC | - | ||
209 | N6-(pyridoxal phosphate)lysine | IVTHSATKWIGGHGT EEEEECCCCCCCCCC | - | ||
231 | Succinylation | DSGKFPWKDYPEKFP CCCCCCCCCCCHHCC | 23954790 | ||
236 | Ubiquitination | PWKDYPEKFPQFSQP CCCCCCHHCCCCCCC | 19722269 | ||
305 | Acetylation | RHGENALKLAKWLEQ HHHHHHHHHHHHHHH | 22865919 | ||
334 | Acetylation | HSHHENAKKYLSNGF CCCHHHHHHHHHCCC | 24489116 | ||
357 | Acetylation | KDLPNADKETDPFKL CCCCCCCCCCCCCCC | 24489116 | ||
363 | Acetylation | DKETDPFKLSGAQVV CCCCCCCCCCCHHHH | 24489116 | ||
374 | Acetylation | AQVVDNLKLASNLAN HHHHCHHHHHHHHCC | 24489116 | ||
374 | Ubiquitination | AQVVDNLKLASNLAN HHHHCHHHHHHHHCC | 17644757 | ||
377 | Phosphorylation | VDNLKLASNLANVGD HCHHHHHHHHCCCCC | 28152593 | ||
386 | Ubiquitination | LANVGDAKTLVIAPY HCCCCCCEEEEEECC | 17644757 | ||
398 | Acetylation | APYFTTHKQLNDKEK ECCCCCHHHCCCHHH | 24489116 | ||
412 | Acetylation | KLASGVTKDLIRVSV HHHHCCCHHHHHHHH | 24489116 | ||
412 | Ubiquitination | KLASGVTKDLIRVSV HHHHCCCHHHHHHHH | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYSD_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYSD_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYSD_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...