| UniProt ID | LDS1_YEAST | |
|---|---|---|
| UniProt AC | P31379 | |
| Protein Name | Outer spore wall protein LDS1 {ECO:0000305|PubMed:23966878} | |
| Gene Name | LDS1 {ECO:0000303|PubMed:23966878} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 325 | |
| Subcellular Localization |
Prospore membrane Multi-pass membrane protein . Lipid droplet . Spore wall . Localizes to the ascal side of growing prospore membranes in mid-meiosis II and to the spore wall in post-meiotic cells. Localizes to a specific subset of lipid droplets a |
|
| Protein Description | Involved in spore wall assembly.. | |
| Protein Sequence | MSFTGSLALAGIGGLVYKFGGGQSYEKLPYVNIPFNQYLDKVYKKHFSKVMSRTRYVLMNFFKDAFTGGAFMYPFKGFLEFNTNKSSYSTTMLGILSSYLIMFALVSFVYWATITPMYTAFLIVLGPIGLFIAIFHSFLQANVFTLLFMRLSHFNNHLVEVCLEKNGLEENLSEVKPIKYYAPINSIYFWAYYFPFKLVKYMLGLSVLFVLLVISFFPLIGPILFHILISPFITQIYFTKVLRLQNFDNIQRRENIYLHAGQYASFGFLAGLIESVPILAGFAISTNTIGSVLFNLDHPMVPENLVETQAEIEAAPQDINQQPNQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of LDS1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LDS1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LDS1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LDS1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MNE1_YEAST | MNE1 | genetic | 27708008 | |
| NU170_YEAST | NUP170 | genetic | 27708008 | |
| VMA21_YEAST | VMA21 | genetic | 27708008 | |
| STB5_YEAST | STB5 | genetic | 27708008 | |
| ILM1_YEAST | ILM1 | genetic | 27708008 | |
| DAN1_YEAST | DAN1 | genetic | 27708008 | |
| BPT1_YEAST | BPT1 | genetic | 27708008 | |
| COA4_YEAST | COA4 | genetic | 27708008 | |
| SWS2_YEAST | SWS2 | genetic | 27708008 | |
| BRE5_YEAST | BRE5 | genetic | 27708008 | |
| CY1_YEAST | CYT1 | genetic | 27708008 | |
| ATX2_YEAST | ATX2 | genetic | 27708008 | |
| DIA2_YEAST | DIA2 | genetic | 27708008 | |
| COQ7_YEAST | CAT5 | genetic | 27708008 | |
| LIPA_YEAST | LIP5 | genetic | 27708008 | |
| COX10_YEAST | COX10 | genetic | 27708008 | |
| RTC6_YEAST | RTC6 | genetic | 27708008 | |
| QCR2_YEAST | QCR2 | genetic | 27708008 | |
| RRT8_YEAST | RRT8 | genetic | 27216456 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
