| UniProt ID | UBC11_YEAST | |
|---|---|---|
| UniProt AC | P52492 | |
| Protein Name | Ubiquitin-conjugating enzyme E2-18 kDa | |
| Gene Name | UBC11 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 156 | |
| Subcellular Localization | ||
| Protein Description | Catalyzes the covalent attachment of ubiquitin to other proteins.. | |
| Protein Sequence | MAVEEGGCVTKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDADMEEYRKKVLACYEEIDDY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of UBC11_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBC11_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBC11_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBC11_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SWC5_YEAST | SWC5 | genetic | 17314980 | |
| SUS1_YEAST | SUS1 | genetic | 17314980 | |
| NGG1_YEAST | NGG1 | genetic | 17314980 | |
| PAT1_YEAST | PAT1 | genetic | 17314980 | |
| IST3_YEAST | IST3 | genetic | 17314980 | |
| EAF5_YEAST | EAF5 | genetic | 17314980 | |
| TAF13_YEAST | TAF13 | genetic | 17314980 | |
| MED20_YEAST | SRB2 | genetic | 17314980 | |
| TFS2_YEAST | DST1 | genetic | 17314980 | |
| UBP11_YEAST | UBP11 | genetic | 17314980 | |
| TOP1_YEAST | TOP1 | genetic | 17314980 | |
| SWR1_YEAST | SWR1 | genetic | 17314980 | |
| HIR3_YEAST | HIR3 | genetic | 17314980 | |
| ISW2_YEAST | ISW2 | genetic | 17314980 | |
| SSD1_YEAST | SSD1 | genetic | 17314980 | |
| RGP1_YEAST | RGP1 | genetic | 17314980 | |
| CSF1_YEAST | CSF1 | genetic | 17314980 | |
| PMT2_YEAST | PMT2 | genetic | 23891562 | |
| VPS24_YEAST | VPS24 | genetic | 23891562 | |
| TGL2_YEAST | TGL2 | genetic | 23891562 | |
| UBC11_YEAST | UBC11 | physical | 14747994 | |
| RTF1_YEAST | RTF1 | genetic | 27708008 | |
| POC4_YEAST | POC4 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
