| UniProt ID | SOL1_YEAST | |
|---|---|---|
| UniProt AC | P50278 | |
| Protein Name | 6-phosphogluconolactonase-like protein 1 | |
| Gene Name | SOL1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 321 | |
| Subcellular Localization | Cytoplasm. Nucleus. | |
| Protein Description | May be involved in regulation of tRNA subcellular distribution.. | |
| Protein Sequence | MTTTVPKVFAFHEFAGVAEAVADHVIHAQNSALKKGKVSRSTQMSGTSLNGNGNTESKTMERVNSVRSNASSRGGSEDGATKKLKKEKERRFKIALSGGSLIQVLHEGLLKRDDVQWGKWDIYFADERLVPFSSSESNYGLAKRKIFDLIDTEKYGTPKIYHIDESLINDPQECADNYEKILIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPNFQENLRENLAWVIPVENAPSGPSNRISLTIPVICHSHRVTFVVEGATKAPVIKTIMERPEKGLPSSIVNEGAAGRVSWFVDDDALKDVFVIKKKYKFYDDENLTE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 39 | Phosphorylation | ALKKGKVSRSTQMSG HHHCCCCCCCCCCCC | 24.81 | 20377248 | |
| 41 | Phosphorylation | KKGKVSRSTQMSGTS HCCCCCCCCCCCCCC | 18.58 | 22369663 | |
| 42 | Phosphorylation | KGKVSRSTQMSGTSL CCCCCCCCCCCCCCC | 27.47 | 20377248 | |
| 45 | Phosphorylation | VSRSTQMSGTSLNGN CCCCCCCCCCCCCCC | 29.15 | 22369663 | |
| 47 | Phosphorylation | RSTQMSGTSLNGNGN CCCCCCCCCCCCCCC | 23.80 | 22369663 | |
| 48 | Phosphorylation | STQMSGTSLNGNGNT CCCCCCCCCCCCCCC | 24.30 | 22369663 | |
| 55 | Phosphorylation | SLNGNGNTESKTMER CCCCCCCCCCHHHHH | 42.93 | 22369663 | |
| 57 | Phosphorylation | NGNGNTESKTMERVN CCCCCCCCHHHHHHH | 31.24 | 22369663 | |
| 58 | Ubiquitination | GNGNTESKTMERVNS CCCCCCCHHHHHHHH | 45.73 | 23749301 | |
| 59 | Phosphorylation | NGNTESKTMERVNSV CCCCCCHHHHHHHHH | 33.28 | 21440633 | |
| 65 | Phosphorylation | KTMERVNSVRSNASS HHHHHHHHHHHCCCC | 18.95 | 22369663 | |
| 68 | Phosphorylation | ERVNSVRSNASSRGG HHHHHHHHCCCCCCC | 34.29 | 22369663 | |
| 71 | Phosphorylation | NSVRSNASSRGGSED HHHHHCCCCCCCCCC | 25.48 | 22369663 | |
| 72 | Phosphorylation | SVRSNASSRGGSEDG HHHHCCCCCCCCCCC | 32.31 | 22369663 | |
| 76 | Phosphorylation | NASSRGGSEDGATKK CCCCCCCCCCCCCCH | 35.03 | 20377248 | |
| 81 | Phosphorylation | GGSEDGATKKLKKEK CCCCCCCCCHHHHHH | 33.95 | 22369663 | |
| 111 | Acetylation | VLHEGLLKRDDVQWG HHHHHHCCCCCCCCC | 59.84 | 24489116 | |
| 139 | Phosphorylation | FSSSESNYGLAKRKI CCCCCCCCHHCCHHH | 23.85 | 23749301 | |
| 143 | Ubiquitination | ESNYGLAKRKIFDLI CCCCHHCCHHHHHHH | 60.30 | 23749301 | |
| 152 | Phosphorylation | KIFDLIDTEKYGTPK HHHHHHCHHHHCCCC | 27.64 | 25882841 | |
| 320 | Phosphorylation | FYDDENLTE------ CCCCCCCCC------ | 51.75 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SOL1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SOL1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SOL1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-45; SER-48; SER-65;SER-68 AND THR-320, AND MASS SPECTROMETRY. | |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65; SER-68 AND SER-71,AND MASS SPECTROMETRY. | |
| "Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65, AND MASSSPECTROMETRY. | |
| "Phosphoproteome analysis by mass spectrometry and its application toSaccharomyces cerevisiae."; Ficarro S.B., McCleland M.L., Stukenberg P.T., Burke D.J., Ross M.M.,Shabanowitz J., Hunt D.F., White F.M.; Nat. Biotechnol. 20:301-305(2002). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-45; SER-48; SER-65 ANDSER-68, AND MASS SPECTROMETRY. | |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-320, AND MASSSPECTROMETRY. | |
| "Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway."; Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.; Mol. Cell. Proteomics 4:310-327(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-320, AND MASSSPECTROMETRY. | |