| UniProt ID | HNT1_YEAST | |
|---|---|---|
| UniProt AC | Q04344 | |
| Protein Name | Hit family protein 1 | |
| Gene Name | HNT1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 158 | |
| Subcellular Localization | ||
| Protein Description | Hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2. Essential for growth on galactose media at elevated temperatures.. | |
| Protein Sequence | MEPLISAPYLTTTKMSAPATLDAACIFCKIIKSEIPSFKLIETKYSYAFLDIQPTAEGHALIIPKYHGAKLHDIPDEFLTDAMPIAKRLAKAMKLDTYNVLQNNGKIAHQEVDHVHFHLIPKRDEKSGLIVGWPAQETDFDKLGKLHKELLAKLEGSD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 32 | Acetylation | CIFCKIIKSEIPSFK HHHHHHHHHHCCCCE | 45.57 | 24489116 | |
| 39 | Acetylation | KSEIPSFKLIETKYS HHHCCCCEEEEEECE | 53.55 | 24489116 | |
| 44 | Ubiquitination | SFKLIETKYSYAFLD CCEEEEEECEEEEEE | 21.29 | 23749301 | |
| 65 | Ubiquitination | GHALIIPKYHGAKLH CCEEEEECCCCCCHH | 39.20 | 22817900 | |
| 70 | Acetylation | IPKYHGAKLHDIPDE EECCCCCCHHCCCCH | 51.45 | 24489116 | |
| 70 | Ubiquitination | IPKYHGAKLHDIPDE EECCCCCCHHCCCCH | 51.45 | 23749301 | |
| 94 | Acetylation | KRLAKAMKLDTYNVL HHHHHHHCCCHHHHH | 48.33 | 24489116 | |
| 126 | Acetylation | LIPKRDEKSGLIVGW ECCCCCCCCCCEEEE | 54.86 | 24489116 | |
| 142 | Acetylation | AQETDFDKLGKLHKE CCCCCHHHHHHHHHH | 60.16 | 24489116 | |
| 145 | Acetylation | TDFDKLGKLHKELLA CCHHHHHHHHHHHHH | 58.83 | 24489116 | |
| 148 | Acetylation | DKLGKLHKELLAKLE HHHHHHHHHHHHHHC | 61.57 | 22865919 | |
| 153 | Acetylation | LHKELLAKLEGSD-- HHHHHHHHHCCCC-- | 47.22 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HNT1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HNT1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HNT1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
