| UniProt ID | VATD_YEAST | |
|---|---|---|
| UniProt AC | P32610 | |
| Protein Name | V-type proton ATPase subunit D | |
| Gene Name | VMA8 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 256 | |
| Subcellular Localization | ||
| Protein Description | Subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system.. | |
| Protein Sequence | MSGNREQVFPTRMTLGLMKTKLKGANQGYSLLKRKSEALTKRFRDITKRIDDAKQKMGRVMQTAAFSLAEVSYATGENIGYQVQESVSTARFKVRARQENVSGVYLSQFESYIDPEINDFRLTGLGRGGQQVQRAKEIYSRAVETLVELASLQTAFIILDEVIKVTNRRVNAIEHVIIPRTENTIAYINSELDELDREEFYRLKKVQEKKQNETAKLDAEMKLKRDRAEQDASEVAADEEPQGETLVADQEDDVIF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 | Ubiquitination | RMTLGLMKTKLKGAN HHHHHHHHHHCCCCH | 47.77 | 23749301 | |
| 19 | Acetylation | RMTLGLMKTKLKGAN HHHHHHHHHHCCCCH | 47.77 | 24489116 | |
| 21 | Ubiquitination | TLGLMKTKLKGANQG HHHHHHHHCCCCHHH | 42.56 | 22817900 | |
| 23 | Ubiquitination | GLMKTKLKGANQGYS HHHHHHCCCCHHHHH | 58.49 | 22817900 | |
| 54 | 2-Hydroxyisobutyrylation | TKRIDDAKQKMGRVM HHHHHHHHHHHHHHH | 58.40 | - | |
| 136 | Ubiquitination | GQQVQRAKEIYSRAV HHHHHHHHHHHHHHH | 47.00 | 23749301 | |
| 233 | Phosphorylation | DRAEQDASEVAADEE HHHHHHHHHHHCCCC | 40.67 | 27214570 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VATD_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VATD_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VATD_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...