CI016_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CI016_HUMAN
• UniProt AC: Q9BUW7
• Protein Name: UPF0184 protein C9orf16
• Gene Name: C9orf16
• Organism: Homo sapiens (Human).
• Sequence Length: 83
• Protein Sequence: MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSDASP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CI016_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CI016_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CI016_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CI016_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CE290_HUMAN	CEP290	physical	25416956
VATE2_HUMAN	ATP6V1E2	physical	25416956
IKIP_HUMAN	IKBIP	physical	25416956
VATE2_HUMAN	ATP6V1E2	physical	21516116

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.