| UniProt ID | USE1_YEAST | |
|---|---|---|
| UniProt AC | P53146 | |
| Protein Name | Protein transport protein USE1 | |
| Gene Name | USE1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 245 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type IV membrane protein . |
|
| Protein Description | SNARE required for targeting and fusion of Golgi-derived retrograde transport vesicles with the ER.. | |
| Protein Sequence | MAETSNDPFLSYVLSSKQLTNLNRLRRKAVTKQLGSSDDNKVSEEFLRYQHTYQREAFEYLQTKHDAHKIMESQYEQYQSSSKTRRYSIDLDSVDAVDTESQTEYPNEEFIDRNEDSEAVMELRKRLLGKGQNKGLGYETTKSVDRQIEDQDTLQQDLIQDMSKLVGSLKQGAVAFQSALDEDKQVLGAAEIGIQVASQGLMDVSGKLRKYDKSKLSYLFYITVFIFMILGLVFTFIIIQLFPAL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MAETSNDPFLS ----CCCCCCCHHHH | 24.24 | 26447709 | |
| 5 | Phosphorylation | ---MAETSNDPFLSY ---CCCCCCCHHHHH | 30.64 | 26447709 | |
| 11 | Phosphorylation | TSNDPFLSYVLSSKQ CCCCHHHHHHCCHHH | 17.36 | 26447709 | |
| 12 | Phosphorylation | SNDPFLSYVLSSKQL CCCHHHHHHCCHHHC | 13.93 | 26447709 | |
| 15 | Phosphorylation | PFLSYVLSSKQLTNL HHHHHHCCHHHCCCH | 25.99 | 26447709 | |
| 16 | Phosphorylation | FLSYVLSSKQLTNLN HHHHHCCHHHCCCHH | 21.91 | 26447709 | |
| 32 | Ubiquitination | LRRKAVTKQLGSSDD HHHHHHHHHHCCCCC | 36.61 | 23749301 | |
| 41 | Ubiquitination | LGSSDDNKVSEEFLR HCCCCCCHHCHHHHH | 54.88 | 23749301 | |
| 88 | Phosphorylation | SSKTRRYSIDLDSVD CCCCCCEEECCCCCC | 14.07 | 19779198 | |
| 93 | Phosphorylation | RYSIDLDSVDAVDTE CEEECCCCCCEECCC | 29.24 | 19779198 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of USE1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of USE1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of USE1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
