| UniProt ID | UPS3_YEAST | |
|---|---|---|
| UniProt AC | Q04006 | |
| Protein Name | Protein UPS3, mitochondrial | |
| Gene Name | UPS3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 179 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side. Mitochondrion intermembrane space. Lacks the two major intermembrane space-targeting signals, bipartite presequences and cysteine motifs, and import is mediated by another |
|
| Protein Description | Required for mitochondrial morphology. With UPS1 and UPS2, controls phospholipid metabolism in the mitochondrial intermembrane space.. | |
| Protein Sequence | MKSFQKSYEFDYPWEKVTTANWMKYPNKISTHVIAVDVLRRELKEHGDVLLTERLITIRQNTPHWMSILVGNTNLAYVREVSTVDRRDRSLTMRSCNMTFPHILKCYETVRYVPHPKNPSNVTLFKQDAKFLSGVPTKTFSEKVENWGVKRFSDNAVKGKVGFDSILAMFNDIWKNANE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 153 | Phosphorylation | NWGVKRFSDNAVKGK HHCCCCCCCCCCCCC | 33.71 | 25533186 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UPS3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UPS3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UPS3_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UPS2_YEAST | UPS2 | genetic | 19506038 | |
| WHI5_YEAST | WHI5 | genetic | 20093466 | |
| QCR2_YEAST | QCR2 | genetic | 20093466 | |
| VMA21_YEAST | VMA21 | genetic | 27708008 | |
| ERV29_YEAST | ERV29 | genetic | 27708008 | |
| SNF6_YEAST | SNF6 | genetic | 27708008 | |
| IMP2_YEAST | IMP2 | genetic | 27708008 | |
| QCR2_YEAST | QCR2 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
