| UniProt ID | TEM1_YEAST | |
|---|---|---|
| UniProt AC | P38987 | |
| Protein Name | Protein TEM1 | |
| Gene Name | TEM1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 245 | |
| Subcellular Localization | ||
| Protein Description | GTP-binding protein involved in termination of M phase. May play a role in triggering the degradation of G2 cyclin to inactivate M-phase promoting factor at the termination of mitosis. Acts upstream of CDC15 kinase and may be required to activate the CDC15 protein kinase pathway.. | |
| Protein Sequence | MATPSTGANNSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYGLNDSAIPILVGTKYDLLIDLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKHLGGQQHRHHNKSQDRKSHNIRKPSSSPSSKAPSPGVNT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MATPSTGANNSI ---CCCCCCCCCCCC | 34.81 | 30377154 | |
| 11 | Phosphorylation | PSTGANNSIPAVRNQ CCCCCCCCCCHHHCC | 29.74 | 30377154 | |
| 40 | Phosphorylation | KTSLMVKYVQNIYDK CHHHHHHHHHHHCCH | 8.89 | 28889911 | |
| 45 | Phosphorylation | VKYVQNIYDKEYTQT HHHHHHHCCHHHHHH | 28.63 | 28889911 | |
| 47 | Ubiquitination | YVQNIYDKEYTQTLG HHHHHCCHHHHHHHC | 35.33 | 23749301 | |
| 231 | Phosphorylation | SHNIRKPSSSPSSKA HCCCCCCCCCCCCCC | 46.62 | 22369663 | |
| 232 | Phosphorylation | HNIRKPSSSPSSKAP CCCCCCCCCCCCCCC | 55.59 | 22369663 | |
| 233 | Phosphorylation | NIRKPSSSPSSKAPS CCCCCCCCCCCCCCC | 32.89 | 22369663 | |
| 235 | Phosphorylation | RKPSSSPSSKAPSPG CCCCCCCCCCCCCCC | 46.55 | 22369663 | |
| 236 | Phosphorylation | KPSSSPSSKAPSPGV CCCCCCCCCCCCCCC | 35.90 | 22369663 | |
| 240 | Phosphorylation | SPSSKAPSPGVNT-- CCCCCCCCCCCCC-- | 38.86 | 22369663 | |
| 245 | Phosphorylation | APSPGVNT------- CCCCCCCC------- | 37.27 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TEM1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TEM1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TEM1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
