ECI1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ECI1_YEAST
• UniProt AC: Q05871
• Protein Name: 3,2-trans-enoyl-CoA isomerase
• Gene Name: ECI1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 280
• Subcellular Localization: Peroxisome . This location is DCI1 dependent.
• Protein Description: Essential for the beta oxidation of unsaturated fatty acids..
• Protein Sequence: MSQEIRQNEKISYRIEGPFFIIHLMNPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIAKAQGDDTNKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKRFRQLGSKQRKHRL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of ECI1_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ECI1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ECI1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ECI1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DCI1_YEAST	DCI1	genetic	10455114
APC11_YEAST	APC11	genetic	27708008
RMRP_YEAST	SNM1	genetic	27708008
BIG1_YEAST	BIG1	genetic	27708008
NTR2_YEAST	NTR2	genetic	27708008
NSE1_YEAST	NSE1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.