UniProt ID | F16P_YEAST | |
---|---|---|
UniProt AC | P09201 | |
Protein Name | Fructose-1,6-bisphosphatase | |
Gene Name | FBP1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 348 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPTLVNGPRRDSTEGFDTDIITLPRFIIEHQKQFKNATGDFTLVLNALQFAFKFVSHTIRRAELVNLVGLAGASNFTGDQQKKLDVLGDEIFINAMRASGIIKVLVSEEQEDLIVFPTNTGSYAVCCDPIDGSSNLDAGVSVGTIASIFRLLPDSSGTINDVLRCGKEMVAACYAMYGSSTHLVLTLGDGVDGFTLDTNLGEFILTHPNLRIPPQKAIYSINEGNTLYWNETIRTFIEKVKQPQADNNNKPFSARYVGSMVADVHRTFLYGGLFAYPCDKKSPNGKLRLLYEAFPMAFLMEQAGGKAVNDRGERILDLVPSHIHDKSSIWLGSSGEIDKFLDHIGKSQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | VNGPRRDSTEGFDTD CCCCCCCCCCCCCCC | 26.92 | 3038868 | |
13 | Phosphorylation | NGPRRDSTEGFDTDI CCCCCCCCCCCCCCC | 44.40 | 29136822 | |
18 | Phosphorylation | DSTEGFDTDIITLPR CCCCCCCCCCEECCH | 27.17 | 29136822 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
12 | S | Phosphorylation | Kinase | PKA-FAMILY | - | GPS |
12 | S | Phosphorylation | Kinase | PKA_GROUP | - | PhosphoELM |
- | K | Ubiquitination | E3 ubiquitin ligase | GRR1 | P24814 | PMID:22199232 |
- | K | Ubiquitination | E3 ubiquitin ligase | RMD5 | Q12508 | PMID:22199232 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of F16P_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of F16P_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...