dbPTM

HPA3_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HPA3_YEAST
UniProt AC	P39979
Protein Name	D-amino-acid N-acetyltransferase HPA3 {ECO:0000303\|PubMed:15375647}
Gene Name	HPA3 {ECO:0000303\|PubMed:10600387}
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	161
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	N-acetyltransferase that acetylates histone H4 at 'Lys-8'. Also acetylates polyamines like putrescine, spermidine and spermine. [PubMed: 23775086 Acts on a wide range of D-amino acids. Catalyzes the N-acetylation through an ordered bi-bi mechanism, in which acetyl-CoA is the first substrate to be bound and CoA is the last product to be liberated]
Protein Sequence	MSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVKLWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSNEEPEKM ------CCCCCHHHH	66.41	22814378
39	Acetylation	KEYQGFQKTVMPPEV HHHHCCCCCCCCHHH	43.20	24489116
57	Acetylation	TFARFIDPTVKLWGA HHHHHCCCCHHHHEE	40.60	-
146	Acetylation	RAQLLYTKVAYKTDK HHHHHHEHHHHHCCC	13.58	24489116
164	Acetylation	KRNGY---------- CCCCC----------	16.00	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HPA3_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HPA3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HPA3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HPA3_YEAST	HPA3	physical	11283351
CDC10_YEAST	CDC10	genetic	18676811
LSM7_YEAST	LSM7	genetic	18676811
MAK32_YEAST	MAK32	genetic	18676811
RM16_YEAST	MRPL16	genetic	18676811
HPA3_YEAST	HPA3	physical	23775086
H4_CHICK	HIST1H47	physical	23775086
COQ11_YEAST	YLR290C	genetic	27708008
GEM1_YEAST	GEM1	genetic	27708008
HAP3_YEAST	HAP3	genetic	27708008
SHE1_YEAST	SHE1	genetic	27708008
RV167_YEAST	RVS167	genetic	27708008
YGY5_YEAST	YGL235W	genetic	27708008
MTO1_YEAST	MTO1	genetic	27708008
CHO2_YEAST	CHO2	genetic	27708008
COX23_YEAST	COX23	genetic	27708008
ICE2_YEAST	ICE2	genetic	27708008
PTK2_YEAST	PTK2	genetic	27708008
HAP4_YEAST	HAP4	genetic	27708008
COXM1_YEAST	CMC1	genetic	27708008
ELO3_YEAST	ELO3	genetic	27708008
ATP10_YEAST	ATP10	genetic	27708008
ATP18_YEAST	ATP18	genetic	27708008
MSS1_YEAST	MSS1	genetic	27708008
MGR3_YEAST	MGR3	genetic	27708008
SSO2_YEAST	SSO2	genetic	27708008
COX5A_YEAST	COX5A	genetic	27708008
EOS1_YEAST	EOS1	genetic	27708008
RCF2_YEAST	RCF2	genetic	27708008
ATP23_YEAST	ATP23	genetic	27708008
HMI1_YEAST	HMI1	genetic	27708008
MSN1_YEAST	MSN1	genetic	27708008
LEO1_YEAST	LEO1	genetic	27708008
MSC6_YEAST	MSC6	genetic	27708008
MDL2_YEAST	MDL2	genetic	27708008
YME1_YEAST	YME1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HPA3_YEAST

Related Literatures of Post-Translational Modification