dbPTM

NIF3_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NIF3_YEAST
UniProt AC	P53081
Protein Name	NGG1-interacting factor 3 {ECO:0000303\|PubMed:8663102}
Gene Name	NIF3 {ECO:0000312\|SGD:S000003189}
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	288
Subcellular Localization
Protein Description
Protein Sequence	MSRAITRAQLDKLVRSITKFYPQKYADKSWDNTGLLIDCSTAQVTTADANAKTKVLLTVDLTKSVAQEAVDANCNVIVAYHPFIFPSWNRLSPHTNPQHETAIKLIQYGISVYCPHTAVDAARGGVNDWLVRGLNNGENVAKSYALETVSGETDDLIGYGRFVEFNKDISLEQIVKNVKRVLRVPYVQVASLAAPSAWNQLKIKKVAVCAGSGSGVFKQLKEDVDLYYTGEMSHHEVLKWKEMGKTVIVCNHSNTERGFLQDVMKGLLQDEGHEVVVSKMDCDPLTVA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	DKLVRSITKFYPQKY HHHHHHHHHHCCHHH	19.15	28889911
58	Phosphorylation	AKTKVLLTVDLTKSV CCCEEEEEEECCHHH	14.07	22369663
62	Phosphorylation	VLLTVDLTKSVAQEA EEEEEECCHHHHHHH	19.46	22369663
176	Acetylation	ISLEQIVKNVKRVLR CCHHHHHHHHHHHHC	58.62	24489116
214	Phosphorylation	AVCAGSGSGVFKQLK EEECCCCCHHHHHHH	33.22	21440633
218	Acetylation	GSGSGVFKQLKEDVD CCCCHHHHHHHHCCC	52.92	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NIF3_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NIF3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NIF3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NIF3_YEAST	NIF3	physical	10688190
NIF3_YEAST	NIF3	physical	18719252
RS29B_YEAST	RPS29B	genetic	27708008
RAD4_YEAST	RAD4	genetic	27708008
CTK1_YEAST	CTK1	genetic	27708008
RAD10_YEAST	RAD10	genetic	27708008
ELP3_YEAST	ELP3	genetic	27708008
YP096_YEAST	YPR096C	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NIF3_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-18, AND MASSSPECTROMETRY.	18407956 [Abstract]