UniProt ID | YBY7_YEAST | |
---|---|---|
UniProt AC | P38276 | |
Protein Name | UPF0303 protein YBR137W | |
Gene Name | YBR137W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 179 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MVVLDKKLLERLTSRKVPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESLEEDLNLD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
51 | Ubiquitination | TYIRNAVKENFPEKP HHHHHHHHHHCCCCC | 44.52 | 17644757 | |
57 | Ubiquitination | VKENFPEKPVAIDIS HHHHCCCCCEEEEEE | 45.06 | 17644757 | |
91 | Ubiquitination | NDFWIQRKKKTALRF CCCEEECCCCHHHHC | 42.10 | 17644757 | |
117 | Ubiquitination | GDKTPEEKFFVDSKE CCCCCHHHCEECCHH | 42.30 | 17644757 | |
117 | Acetylation | GDKTPEEKFFVDSKE CCCCCHHHCEECCHH | 42.30 | 24489116 | |
123 | Ubiquitination | EKFFVDSKEYAFHGG HHCEECCHHCEEECC | 50.73 | 17644757 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBY7_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBY7_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBY7_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...