| UniProt ID | NDK_YEAST | |
|---|---|---|
| UniProt AC | P36010 | |
| Protein Name | Nucleoside diphosphate kinase | |
| Gene Name | YNK1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 153 | |
| Subcellular Localization | Cytoplasm . Mitochondrion intermembrane space . Localizes predominantly to the cytoplasm. A small fraction is present in the mitochondrial intermembrane space. | |
| Protein Description | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Required for repair of UV radiation- and etoposide-induced DNA damage.. | |
| Protein Sequence | MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 13 | Ubiquitination | ERTFIAVKPDGVQRG EEEEEEECCCHHHHH | 28.50 | 23749301 | |
| 13 | Acetylation | ERTFIAVKPDGVQRG EEEEEEECCCHHHHH | 28.50 | 24489116 | |
| 40 | 2-Hydroxyisobutyrylation | GYKLVAIKLVKADDK CCEEEEEEEEECCHH | 37.17 | - | |
| 40 | Acetylation | GYKLVAIKLVKADDK CCEEEEEEEEECCHH | 37.17 | 24489116 | |
| 43 | Succinylation | LVAIKLVKADDKLLE EEEEEEEECCHHHHH | 57.44 | 23954790 | |
| 47 | Acetylation | KLVKADDKLLEQHYA EEEECCHHHHHHHHH | 56.36 | 24489116 | |
| 53 | Phosphorylation | DKLLEQHYAEHVGKP HHHHHHHHHHHCCCC | 17.24 | 21440633 | |
| 59 | Acetylation | HYAEHVGKPFFPKMV HHHHHCCCCCHHHHH | 37.25 | 24489116 | |
| 64 | Acetylation | VGKPFFPKMVSFMKS CCCCCHHHHHHHHHC | 46.94 | 24489116 | |
| 67 | Phosphorylation | PFFPKMVSFMKSGPI CCHHHHHHHHHCCCE | 19.00 | 21440633 | |
| 71 | Phosphorylation | KMVSFMKSGPILATV HHHHHHHCCCEEEEE | 37.70 | 21440633 | |
| 82 | Acetylation | LATVWEGKDVVRQGR EEEEECCCHHHHCCC | 35.52 | 24489116 | |
| 95 | Phosphorylation | GRTILGATNPLGSAP CCEEEEECCCCCCCC | 35.25 | 25752575 | |
| 100 | Phosphorylation | GATNPLGSAPGTIRG EECCCCCCCCCCCCC | 38.69 | 29734811 | |
| 121 | Phosphorylation | GRNVCHGSDSVDSAE CCCCCCCCCCCCHHH | 11.75 | 23749301 | |
| 123 | Phosphorylation | NVCHGSDSVDSAERE CCCCCCCCCCHHHHH | 29.53 | 23749301 | |
| 126 | Phosphorylation | HGSDSVDSAEREINL CCCCCCCHHHHHHHH | 29.85 | 19779198 | |
| 137 | 2-Hydroxyisobutyrylation | EINLWFKKEELVDWE HHHHEEEHHHHCCCC | 47.12 | - | |
| 137 | Acetylation | EINLWFKKEELVDWE HHHHEEEHHHHCCCC | 47.12 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDK_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDK_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDK_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-95, AND MASSSPECTROMETRY. | |
