| UniProt ID | SPO12_YEAST | |
|---|---|---|
| UniProt AC | P17123 | |
| Protein Name | Sporulation-specific protein 12 | |
| Gene Name | SPO12 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 173 | |
| Subcellular Localization | ||
| Protein Description | It is required for meiosis I chromosome division during sporulation. A component of the FEAR (CDC14 early anaphase release) network which promotes CDC14 release from the nucleolus during early anaphase.. | |
| Protein Sequence | MSNKASDQSARTASILKTDITRENTITRSSSSNNDNYHHHNNINNYNESAKTGEDANKENIPNLEEEIAAFRIFRKKSTSNLKSSHTTSNLVKKTMFKRDLLKQDPKRKLQLQQRFASPTDRLVSPCSLKLNEHKVKMFGKKKKVNPMKLNFKGNLAADSEDVEIDEDEEYFY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSNKASDQS ------CCCHHCHHH | 47.22 | 22814378 | |
| 31 | Phosphorylation | NTITRSSSSNNDNYH CCCCCCCCCCCCCCC | 38.03 | 19779198 | |
| 78 | Phosphorylation | FRIFRKKSTSNLKSS HHHHHHHCCCCCCCC | 39.85 | 27017623 | |
| 79 | Phosphorylation | RIFRKKSTSNLKSSH HHHHHHCCCCCCCCC | 30.43 | 27017623 | |
| 84 | Phosphorylation | KSTSNLKSSHTTSNL HCCCCCCCCCHHHHH | 30.44 | 28889911 | |
| 85 | Phosphorylation | STSNLKSSHTTSNLV CCCCCCCCCHHHHHH | 24.22 | 27017623 | |
| 87 | Phosphorylation | SNLKSSHTTSNLVKK CCCCCCCHHHHHHHH | 33.59 | 28889911 | |
| 88 | Phosphorylation | NLKSSHTTSNLVKKT CCCCCCHHHHHHHHH | 15.36 | 28889911 | |
| 118 | Phosphorylation | QLQQRFASPTDRLVS HHHHHHCCCCCCCCC | 26.14 | 21551504 | |
| 120 | Phosphorylation | QQRFASPTDRLVSPC HHHHCCCCCCCCCCC | 31.12 | 21551504 | |
| 125 | Phosphorylation | SPTDRLVSPCSLKLN CCCCCCCCCCCCCCC | 25.44 | 21551504 | |
| 128 | Phosphorylation | DRLVSPCSLKLNEHK CCCCCCCCCCCCHHH | 31.74 | 19684113 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPO12_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPO12_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPO12_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
